Details for Chinese cabbage Locus Brara.A03400

Position : A01 ( 5`- 27956812 .. 27957629 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03400

Protein [Map View]
MVFFMSYPPTRRQMMASVGFFAAGVSLFAAGAYLSLENIGPQQARVKARNQFVKDRIRKWLDD*

DNA
ATGGTGTTCTTCATGTCGTATCCGCCGACACGGCGGCAGATGATGGCGTCTGTTGGTTTTTTCGCGGCGGGCGTTTCTCT
CTTCGCAGCCGGAGCGTATCTCTCACTCGAAAATATAGGACCGCAACAAGCTCGCGTCAAGGCTCGGAACCAATTCGTTA
AAGATCGGATCAGGAAATGGCTCGACGATTAG