Details for Chinese cabbage Locus Brara.A03397

Position : A01 ( 5`- 27936287 .. 27936772 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03397

Protein [Map View]
MHALTNSGAVLLAVLLLFLLIFFAELTYIFCRPSPSPASKEVLLQFFMCCKKHQSRIEPTGTVSIQIEEDNGVVVAATEE
EEDVAAVDKWRVSRLLFTIEEDDLEMEDDDDDDGELVRVDIPVECSRVPTPFLTPCDSPPYFTPSPSPCRNVDDDVIDVC
L*

DNA
ATGCATGCCCTCACCAATTCCGGTGCGGTGCTACTCGCCGTCTTACTCCTCTTCCTCCTCATCTTCTTCGCCGAGCTCAC
TTACATCTTCTGTCGTCCATCGCCGTCTCCGGCAAGTAAAGAGGTTCTGCTCCAGTTCTTCATGTGTTGCAAGAAGCACC
AGTCTCGTATTGAGCCAACCGGAACTGTTTCTATTCAGATTGAGGAGGATAATGGTGTTGTTGTTGCGGCGACGGAGGAG
GAGGAGGATGTAGCGGCGGTGGACAAGTGGCGAGTTTCGAGGCTTCTGTTTACAATAGAAGAAGATGATTTGGAAATGGA
AGATGATGATGATGATGACGGTGAACTAGTACGGGTTGATATTCCGGTGGAATGTTCCAGGGTGCCGACTCCGTTCTTGA
CGCCGTGTGATTCTCCTCCTTACTTCACTCCTTCGCCGTCTCCGTGTCGGAATGTGGATGATGATGTCATTGATGTTTGT
TTATGA