Details for Chinese cabbage Locus Brara.A03396

Position : A01 ( 5`- 27934844 .. 27935548 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03396

Protein [Map View]
MGDKHQPYLNGTYYGPSVPPPLKPNRRYKPPGCCCCFNCIGSCLRCCGCCILSLICNILVAVAVILAVTALLIWLIFRPN
AVKLYVTDASLNRFSLDSNNNIKIHYDLDLNFTVRNPNQRLGVYYDAIQVSGYYGEQRFGYVDVSPFYQGHKNTTVVVTK
IEGQNLVVLDDGGRAGVYSIDVKLVMRVRFRFWVVKSWKFKPKVKCNDLKVPLVSSNSTSGFKFETMECDFDFY*

DNA
ATGGGAGACAAACATCAGCCATACCTTAACGGCACATACTACGGCCCATCGGTTCCTCCGCCGCTTAAGCCAAATCGCCG
ATACAAACCACCCGGATGCTGCTGCTGCTTCAACTGCATTGGAAGCTGTCTACGTTGCTGCGGTTGCTGTATCCTAAGCC
TAATCTGCAACATCCTCGTAGCCGTAGCCGTTATCCTCGCCGTAACGGCATTACTTATCTGGCTCATCTTCCGTCCCAAC
GCCGTTAAATTGTACGTAACCGACGCTAGTCTAAACCGGTTCAGCTTGGATTCAAACAACAACATCAAGATACACTACGA
TCTCGATCTCAACTTCACGGTCCGTAACCCTAACCAACGGCTCGGAGTCTACTACGATGCGATCCAGGTCAGTGGTTATT
ACGGAGAACAGCGGTTCGGTTATGTAGACGTTTCGCCGTTCTATCAGGGACATAAAAACACGACGGTTGTTGTGACAAAG
ATCGAGGGACAGAACTTGGTGGTGCTCGACGACGGAGGGAGAGCTGGAGTTTACAGTATCGATGTGAAGCTGGTGATGAG
GGTTAGGTTCAGGTTTTGGGTGGTAAAGTCTTGGAAATTCAAACCGAAGGTTAAGTGTAATGATCTCAAGGTTCCTCTCG
TATCCTCTAATTCAACGAGCGGGTTTAAGTTTGAAACTATGGAGTGTGATTTTGACTTTTATTAG