Details for Chinese cabbage Locus Brara.A03394

Position : A01 ( 5`- 27919091 .. 27921442 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03394

Protein [Map View]
MEMDLNAQVKKAGFFQRLKEFPCKLKDGVTKRIKNVQKFGKDDPRRIIHSLKVGLSLTLVSMLYYVRPLYNSFGVSGMWA
ILTVVVVSEFTVGGTLSKGLNRGFATLIAGALGVGAVHLARFCGDKGEPIVLGIFVFSLGAAATFSRFFPRIKQRYDYGA
LIFILTFSMVAVSGYRTDEILVMAYQRLSTILIGGTICILVSIFVFPVWAGEDLHKMVANNIIKLANSLEGFEGEYFPSS
EKTSKETNSCVQQYKSILTSKSTEDTLANLARWEPGHGRFRLRHPWTKYLKIAGLVRQCAFHFEILNGYVLSDVKIPQDF
ISKIQEPCSIMSREACEALKAIAKSIKTMKRDSVCVNAHIENSKNAIQNLRIALKTSSPETEKDLLEIIPGVTMASILIE
IVNYVEKISEAVEEFSGLAHFKETLDPKVSPELGQHQLLHRGSVKPVLEGDSEEENNSSPHVVINVHDEQPPTTSEKIVS
GVQKTRVGVV*

DNA
ATGGAGATGGACTTGAATGCTCAAGTGAAGAAAGCAGGATTCTTCCAAAGGCTTAAGGAGTTCCCTTGCAAGCTTAAAGA
CGGCGTCACCAAGCGCATAAAGAATGTGCAAAAGTTTGGTAAAGATGATCCAAGACGGATCATCCATTCCTTAAAAGTGG
GACTTTCTCTCACATTAGTATCAATGCTGTACTATGTACGGCCTCTTTATAATAGCTTCGGGGTTTCGGGTATGTGGGCG
ATACTAACCGTAGTCGTAGTCTCCGAGTTCACTGTCGGTGGGACACTTTCAAAAGGTTTAAACAGAGGTTTTGCAACATT
AATAGCCGGTGCCTTAGGGGTTGGTGCAGTACACCTTGCTAGATTCTGTGGAGACAAAGGAGAGCCGATTGTTCTTGGGA
TATTCGTGTTCTCACTAGGCGCAGCTGCAACATTTTCGCGGTTTTTTCCAAGGATTAAACAGAGATATGACTATGGTGCC
TTGATTTTCATACTCACATTCAGCATGGTTGCCGTTTCGGGTTACCGTACAGATGAAATATTGGTTATGGCATATCAAAG
ACTATCCACCATTCTTATTGGTGGAACGATATGCATCCTTGTATCGATCTTCGTTTTTCCTGTATGGGCAGGCGAAGATC
TTCACAAGATGGTTGCTAATAACATTATCAAACTCGCTAACTCTTTAGAAGGTTTCGAGGGTGAATATTTTCCATCATCG
GAGAAGACTTCAAAGGAGACAAATTCGTGTGTTCAACAATACAAAAGCATTCTAACATCAAAAAGCACGGAAGATACTTT
GGCGAATCTTGCGAGATGGGAACCGGGACATGGCCGATTCAGGCTACGCCATCCATGGACAAAGTACTTAAAGATCGCAG
GACTCGTACGTCAATGCGCCTTTCATTTTGAAATCCTCAATGGCTATGTTCTCTCTGACGTTAAGATACCGCAAGATTTC
ATAAGCAAGATTCAAGAGCCATGCTCGATCATGAGCAGAGAAGCTTGTGAAGCCCTAAAAGCCATAGCCAAATCTATCAA
AACAATGAAGAGAGACAGTGTTTGTGTTAATGCACATATTGAAAACTCCAAAAATGCCATACAAAACCTAAGGATTGCAC
TCAAAACGTCTTCTCCAGAGACAGAGAAAGATCTCTTGGAGATCATTCCCGGAGTCACAATGGCGTCAATATTGATCGAG
ATCGTTAATTACGTCGAGAAGATCTCCGAGGCTGTGGAAGAATTCTCCGGTCTGGCACACTTTAAAGAGACTCTGGATCC
AAAAGTGTCACCGGAATTAGGACAACATCAACTACTTCACAGGGGAAGTGTAAAGCCTGTTCTAGAGGGTGACAGCGAGG
AAGAAAACAATAGCTCTCCTCATGTTGTTATCAATGTCCATGATGAACAGCCACCAACAACCAGCGAAAAAATAGTTTCG
GGCGTACAGAAGACGAGAGTAGGTGTCGTGTAG