Details for Chinese cabbage Locus Brara.A03393

Position : A01 ( 5`- 27885474 .. 27886196 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03393

Protein [Map View]
MNMTSRYDPKHMSRQTKPSDTPSSSPSRSHRRHPLLQRSLSSPSPNATCGGSTPAEFCGGTTASCAAVWCCCPCGIVNLV
VLAVYKVPRGICRRAIRSHRRKQLVKNGILPPLPSGERVQRVFQNSEFAIFPLDSNDVSEEEDDGFFDPKYFGKGAAVAA
ELTTDEETDEEDEAVLALEKEMWNRFYGAGFWRSPSQRESVSSPRVSKSLSASPRPSFTEVFRNTAIRGGATVTPRAVWQ
*

DNA
ATGAACATGACGTCACGCTACGATCCGAAACACATGTCGAGGCAGACGAAACCGTCAGACACTCCCTCGTCTTCTCCCTC
TCGTAGTCACCGGAGACACCCTCTCCTCCAAAGAAGCCTCTCCTCCCCGTCTCCGAACGCCACTTGCGGCGGATCAACAC
CCGCCGAGTTCTGCGGCGGCACCACGGCGAGTTGCGCCGCCGTGTGGTGCTGCTGTCCTTGCGGAATAGTCAACCTCGTC
GTCCTCGCCGTCTACAAAGTCCCGCGCGGGATCTGCCGCCGCGCTATCCGCAGTCACCGCCGTAAACAGCTCGTCAAGAA
CGGTATCCTCCCGCCGCTTCCGTCAGGCGAGAGGGTGCAGAGAGTGTTCCAGAACTCGGAGTTCGCTATCTTTCCGTTGG
ATAGTAACGATGTCTCGGAGGAGGAGGACGACGGTTTCTTTGATCCCAAGTACTTCGGGAAGGGCGCAGCGGTTGCGGCT
GAGCTGACGACGGACGAGGAGACCGATGAAGAGGACGAGGCGGTGTTGGCGTTGGAGAAAGAGATGTGGAACAGGTTTTA
CGGTGCTGGATTCTGGAGGAGTCCTTCGCAGAGAGAATCGGTGTCTTCTCCGAGAGTTTCGAAGTCTCTTTCGGCGTCGC
CGAGGCCGTCGTTTACTGAAGTGTTTCGGAACACAGCGATTAGAGGAGGAGCTACGGTGACACCGAGAGCCGTTTGGCAA
TGA