Details for Chinese cabbage Locus Brara.A03389

Position : A01 ( 5`- 27863268 .. 27864582 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03389

Protein [Map View]
MAIVGPNFCAPYPVELGIVRKVMTITDGNFAVTDVNGNLLFKVKEPLFSLSDKRILLDASDTPILTLKENKVSLHDRWQV
FRGKSTDQNDLVYTLKRSSMFQLIKPKLDVFLAHNKEMKECDFHVKGSWIDRSSVIYAGKSDVIVAQMHKKHTAQSILIG
KSNFSVTVYPNVDYAFIVSLIVILDDINREDSED*

DNA
ATGGCGATCGTGGGTCCTAACTTTTGTGCACCGTATCCGGTAGAGTTGGGAATCGTACGAAAGGTGATGACGATAACAGA
TGGTAACTTCGCCGTCACAGACGTTAACGGCAATCTCCTTTTCAAAGTCAAGGAACCATTGTTTAGTCTTTCCGACAAAA
GGATCCTACTCGACGCATCAGACACTCCCATTTTGACTTTGAAAGAAAATAAAGTGAGCCTTCACGATAGGTGGCAAGTG
TTTAGAGGAAAGAGTACGGACCAAAATGATTTGGTATACACGCTGAAACGATCGTCGATGTTTCAGCTGATTAAGCCAAA
GCTAGATGTTTTCTTGGCTCATAATAAGGAAATGAAGGAATGTGACTTCCATGTCAAAGGGAGTTGGATCGACCGGTCAT
CTGTCATCTATGCTGGAAAATCTGACGTCATTGTTGCTCAGATGCACAAGAAACATACCGCACAGAGCATATTGATAGGG
AAGAGTAATTTCTCGGTTACGGTTTATCCGAACGTTGATTATGCGTTTATAGTCTCTCTCATTGTAATCCTCGATGACAT
TAACCGAGAAGATTCCGAAGACTAA