Details for Chinese cabbage Locus Brara.A03387

Position : A01 ( 5`- 27847003 .. 27850799 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03387

Protein [Map View]
MVVKMMKWRPWPPLVTRKYEVKLTVRRLERWDLAREPENERLTVEIRWKGPKATLGSLRRPSVKRDFTKEAAAESDVVSW
EEEELFQSVCSLTSYKEDDTLFYPWEIAFSLFTNGMKQGQKNKAPLVGTASLNLSEYARVTDQREFEINIPLTLSACIAS
EPHPLLCVSLSLFELRTTPETSDSQTAVVPVPSPPPPHQTEKEDVSAIKAGLRKVKIFVSTRKAKKACHREEAEEGRFSS
FESSESLDLSEEASDECKEDLMSVRKSFSYGPLSYANGVGSSLNRGKKVSEEDEDWVYYSHRKSDVGGGGGGGGCCSDVE
DASAGLVYETSSSSLLQRRSILPWRKRKLSFRSPKAKGEPLLKKDNGEEGGDDIDYDRRQLSSDEALVRSKTDEDSSSAN
PQQSSFLEFGDDSFAIGSWEEKEVVSRDGHMKLQTSVFLASIDQRSERAAGESACTALVAVIADWFQKNGNLMPVKSQFD
SLIREGSLEWRNLCENETYMQQFPDKHFDLDTVLQAKIRSLTVVPGKSFVGFFHPEGMINEGSFEFLQGAMSFDSIWDEI
INLDDDECVYIVSWNDHFFVLKVENEAYYIIDTLGERLYEGCDQAYILKFDDKTVIHKNLQEEESESVSEPEVVCRGKES
CKEYIKSFLAAIPIRELQEDIKKGLASTAPVHQRLQIEFHYTKMSTSTDVVAV*

DNA
ATGGTGGTGAAGATGATGAAGTGGCGGCCATGGCCGCCGCTGGTGACGAGGAAATACGAGGTGAAGCTAACGGTGAGGAG
ATTGGAAAGGTGGGATCTGGCGAGGGAGCCGGAGAACGAGAGATTGACGGTGGAGATTCGGTGGAAAGGGCCCAAGGCGA
CGTTGGGGTCTCTGAGGAGGCCGTCTGTGAAAAGAGACTTCACAAAGGAAGCGGCGGCGGAAAGCGACGTCGTTTCGTGG
GAAGAGGAAGAGTTGTTTCAGAGCGTGTGCTCTCTCACTTCTTACAAGGAGGACGACACTCTGTTTTATCCTTGGGAGAT
TGCTTTCTCTCTCTTCACCAATGGAATGAAGCAAGGGCAAAAGAACAAAGCTCCTCTCGTTGGAACTGCATCTCTGAATC
TTTCTGAATACGCACGTGTAACCGATCAAAGAGAGTTTGAAATAAACATCCCTCTCACGCTCTCTGCTTGTATAGCCTCC
GAGCCGCATCCTTTACTCTGTGTATCACTGAGCTTGTTTGAGCTCAGAACCACACCAGAAACCTCAGACTCACAAACAGC
TGTTGTGCCTGTCCCATCTCCACCTCCACCTCACCAAACCGAGAAGGAAGACGTTTCCGCAATCAAAGCCGGTCTAAGGA
AAGTCAAGATCTTCGTTTCCACAAGGAAAGCCAAGAAGGCTTGCCACCGCGAGGAGGCAGAAGAAGGCAGATTCTCAAGC
TTCGAATCCTCCGAATCCCTCGACCTCTCCGAGGAAGCTTCCGACGAATGCAAAGAGGATCTGATGAGTGTGAGAAAGTC
TTTCTCATACGGACCATTGTCTTACGCAAACGGTGTTGGAAGCTCGTTGAACCGCGGCAAGAAAGTGAGCGAAGAAGACG
AAGATTGGGTTTATTACAGCCACAGGAAGTCTGACGTGGGAGGAGGAGGAGGAGGAGGAGGTTGCTGCTCGGACGTTGAA
GATGCGTCTGCTGGTTTGGTGTATGAGACATCATCATCATCGCTTCTTCAGCGTCGTAGCATATTGCCGTGGAGGAAGAG
GAAGCTGAGCTTTAGGTCTCCGAAGGCCAAAGGAGAGCCTTTGTTGAAGAAAGATAACGGTGAAGAAGGTGGAGATGACA
TTGATTATGACCGGAGGCAACTTAGCTCAGATGAAGCTCTTGTGAGGAGCAAAACAGATGAAGATTCTTCATCAGCTAAT
CCTCAACAGTCCTCTTTCTTGGAGTTTGGAGACGACAGTTTCGCTATTGGAAGCTGGGAAGAGAAAGAAGTGGTGAGCAG
AGACGGACACATGAAGCTTCAGACAAGCGTCTTTCTTGCTTCCATCGACCAGAGAAGCGAGCGTGCAGCTGGCGAGAGTG
CATGCACAGCTCTCGTAGCTGTTATCGCAGACTGGTTCCAGAAGAACGGTAACCTCATGCCGGTTAAGTCTCAGTTCGAT
AGTTTGATCAGAGAAGGCTCGTTGGAGTGGAGAAACCTCTGCGAGAACGAGACCTACATGCAGCAGTTCCCCGACAAGCA
TTTTGATCTCGACACTGTGTTACAAGCAAAGATCAGGTCGTTAACTGTTGTCCCAGGGAAGTCTTTTGTCGGTTTTTTCC
ATCCAGAAGGGATGATCAACGAAGGAAGCTTCGAGTTTCTGCAAGGTGCAATGTCTTTCGATAGTATATGGGATGAGATT
ATCAATCTAGACGATGATGAGTGTGTTTACATTGTGAGCTGGAACGATCACTTCTTTGTACTCAAAGTTGAAAACGAAGC
TTACTACATCATTGACACGCTTGGAGAGAGGCTATACGAGGGTTGTGATCAAGCTTACATTTTGAAGTTCGATGATAAGA
CAGTCATCCACAAGAATCTTCAAGAAGAGGAATCAGAGTCTGTGTCTGAACCTGAGGTTGTGTGCAGAGGGAAGGAGTCA
TGTAAAGAGTATATTAAGAGTTTCTTGGCGGCTATACCGATAAGAGAGTTGCAAGAGGATATCAAGAAAGGATTAGCTTC
GACTGCTCCTGTTCACCAACGCTTACAGATCGAGTTTCATTACACGAAGATGAGTACAAGCACAGATGTCGTCGCTGTCT
GA