Details for Chinese cabbage Locus Brara.A03384

Position : A01 ( 5`- 27839312 .. 27843072 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03384

Protein [Map View]
MASMMQPQIILLKEGTDTSQGKAQLLSNINSVTAVGDVVRTTLGPRGMDKLIHDDKGSVTISNDGATIMKLLDIVHPAAK
ILVDIAKSQDSEVGDGTTTVVLLAAEFLKEAKPFVEDGVHSQNLIRSYRTASTLAIEKVKELAVSIEGKSVEEKKGLLAK
CAATTLSSKLIGGEKEFFATMVVDAVMAIGDDDRLNLIGIKKVPGGNMRDSFLVDGVAFKKTFSYAGFEQQPKKFLNPKI
LLLNIELELKSEKENAEIRLSDPSQYQSIVDAEWNIIYDKLDKCVESGAKVVLSRLAIGDLATQYFADRDIFCAGRVAEE
DLNRVAAAAGGTVQTSVNNIIPEVLGTCEIFEEKQVGGERFNIFSGCPSGRTATIVLRGGADQFIEEAERSLHDAIMIVR
RAVKNSTVVPGGGAIDMEISKYLRQHSRTIAGKSQLFINSYAKALEVIPRQLCDNAGFDATDVLNKLRQKHAMQSGEGAS
YGVDINTGGIADSFANFVWEPAVVKINAINAATEAACLILSVDETVKNPKSESAQGDAAAGAMGRGRGGGRGRGMRRR*

DNA
ATGGCGTCGATGATGCAACCGCAAATCATTCTGCTGAAGGAAGGCACAGACACTTCTCAGGGGAAAGCGCAGCTGCTCAG
CAACATCAACTCCGTTACGGCGGTCGGCGACGTGGTTCGAACCACGCTCGGGCCGCGTGGGATGGACAAGCTCATCCACG
ACGATAAGGGATCCGTCACCATTTCCAACGACGGCGCCACCATCATGAAGCTCCTCGACATCGTTCACCCCGCCGCTAAG
ATCCTCGTCGACATCGCCAAATCTCAAGACTCAGAGGTAGGTGATGGGACGACTACAGTTGTGCTTCTTGCAGCTGAGTT
TTTGAAGGAGGCTAAGCCGTTTGTTGAGGATGGTGTTCACTCTCAGAATCTCATTAGGAGTTATCGCACTGCGAGCACTT
TGGCGATTGAGAAGGTGAAAGAACTCGCTGTTAGCATTGAGGGGAAGAGTGTGGAGGAGAAGAAAGGTCTGTTGGCTAAG
TGTGCTGCTACTACTCTTTCGTCGAAGCTTATTGGTGGAGAGAAGGAGTTTTTTGCTACTATGGTTGTTGATGCTGTTAT
GGCTATTGGGGATGACGACAGGCTTAATTTGATTGGGATCAAAAAGGTTCCTGGTGGTAACATGAGAGACTCTTTCCTAG
TTGACGGTGTGGCTTTCAAAAAGACATTCTCATATGCGGGTTTTGAACAACAGCCAAAGAAGTTTCTTAATCCGAAAATC
CTTCTTCTTAACATCGAGCTGGAGTTGAAATCTGAGAAGGAAAACGCTGAGATTAGGCTATCGGATCCATCACAGTACCA
GTCAATAGTCGATGCAGAATGGAATATCATTTATGACAAGCTAGACAAATGTGTCGAAAGTGGAGCAAAAGTTGTTCTTT
CTCGATTGGCTATTGGTGATCTAGCTACTCAGTATTTTGCAGATCGTGATATTTTCTGCGCTGGCCGTGTAGCAGAAGAA
GATCTTAACCGCGTGGCTGCCGCCGCTGGAGGAACAGTTCAGACGAGTGTTAACAATATAATACCCGAGGTTCTCGGAAC
TTGTGAGATATTTGAGGAAAAACAAGTTGGTGGGGAGAGGTTTAACATATTCAGTGGTTGCCCTTCAGGACGTACAGCAA
CTATTGTCCTTCGTGGTGGAGCTGATCAGTTCATCGAAGAAGCTGAGCGGAGTTTACATGATGCTATTATGATTGTGAGG
AGAGCTGTGAAGAACTCAACTGTTGTTCCTGGAGGTGGAGCTATAGATATGGAGATAAGCAAGTACCTGAGGCAGCATTC
ACGAACTATTGCCGGGAAGTCTCAGCTTTTCATTAACTCGTATGCAAAGGCCCTGGAGGTTATTCCACGACAATTATGTG
ACAATGCTGGATTTGATGCAACTGATGTGCTGAATAAATTAAGACAAAAACACGCCATGCAAAGCGGTGAAGGAGCTTCA
TATGGAGTGGACATTAACACTGGTGGAATAGCTGATTCATTTGCTAACTTCGTCTGGGAACCAGCAGTTGTGAAGATTAA
TGCTATAAACGCTGCGACTGAAGCAGCTTGCCTTATCCTTAGTGTGGACGAAACTGTGAAGAACCCTAAATCTGAGAGCG
CACAGGGAGATGCTGCCGCAGGTGCTATGGGAAGAGGACGCGGTGGAGGTCGTGGCCGTGGTATGAGGAGACGATAA