Details for Chinese cabbage Locus Brara.A03383

Position : A01 ( 5`- 27837080 .. 27838774 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03383

Protein [Map View]
MDRVDEEIEIPNYFLCPISLEIMKDPVTAVSGITYDRQSIVQWLEKVPSCPVTKQHLPLDSDLTPNHTLRRLIQHWCVEN
ATRGVARIPTPRAPPGKLNIVEEIKNLKKFVVEASGREETLKKLEVLAMEGETNRRMMCEAGVHRSLILFVVKCTREEEE
EGQHLKGHLDESLRLLHLIGVPLNDARALLIENDQMLESLTLILHQQDFINKAYTIVLLRNLTGNASSHIVERFGAEILK
GIIGFLKDVVISSFNLTSPSVSATLQPSSSSVRSKLDRSLVIKRGVTAALMILLETSSWSRNRTILVDLGAVSELIELEI
SYSGEKRTTELVLGILSHLCCCADGRAEILAHGGGIAIVTKRVLWVSTAADDRALSILSTLSKFSPENEVVEEMVCVGTV
EKLCSVLRVDCGLSLKEKAKEILRDHFDEWKRFPCINVHLHTKLLEQ*

DNA
ATGGATCGTGTAGATGAAGAGATCGAGATCCCTAACTACTTTCTCTGCCCTATTTCACTAGAGATTATGAAAGATCCAGT
CACGGCCGTTTCTGGCATCACATACGACCGTCAAAGTATCGTCCAATGGCTAGAGAAGGTCCCATCTTGTCCCGTGACGA
AGCAGCATCTTCCTTTAGACTCTGATCTTACGCCTAACCATACGCTTCGCCGTCTGATACAACACTGGTGCGTCGAGAAC
GCTACACGTGGCGTTGCTAGAATCCCTACGCCTAGAGCTCCTCCAGGGAAGCTTAACATCGTCGAGGAGATCAAGAATCT
CAAAAAGTTTGTAGTAGAAGCCTCAGGAAGAGAAGAAACGTTGAAGAAGCTTGAAGTTTTGGCTATGGAGGGAGAGACAA
ATAGGAGAATGATGTGTGAAGCAGGCGTACATAGGTCTTTGATCTTGTTCGTAGTCAAGTGTACTCGTGAAGAAGAAGAG
GAGGGACAACATCTCAAAGGACACCTAGATGAATCTCTACGTCTTCTTCACTTGATCGGTGTTCCATTAAACGACGCAAG
AGCACTCTTGATCGAAAACGATCAAATGTTGGAATCATTGACTCTGATCTTACACCAACAAGACTTCATCAACAAGGCTT
ACACAATCGTTCTCTTGAGGAATCTAACGGGAAATGCTTCCTCTCATATCGTCGAGAGGTTCGGTGCCGAGATTTTGAAA
GGGATCATAGGCTTTCTCAAGGATGTAGTAATAAGTAGTTTCAATCTCACTAGCCCTAGCGTGAGTGCTACGTTACAACC
ATCAAGTTCTAGCGTGAGGTCAAAACTTGATCGTAGCCTTGTTATCAAACGTGGTGTGACTGCAGCGCTAATGATTCTTC
TAGAGACCTCTTCTTGGAGCCGGAACCGAACCATCCTTGTGGATCTCGGCGCGGTTTCTGAACTCATCGAACTCGAAATA
AGCTACAGCGGCGAGAAGAGAACCACTGAACTTGTGTTGGGAATTTTGTCTCATTTATGTTGCTGCGCAGATGGTAGAGC
TGAGATTCTTGCTCATGGAGGCGGAATCGCGATTGTGACAAAACGGGTATTGTGGGTTTCGACTGCAGCAGACGATAGAG
CTCTCTCTATCCTAAGCACGTTGTCCAAATTCTCGCCGGAGAACGAAGTGGTGGAAGAGATGGTTTGTGTCGGGACGGTT
GAGAAGCTTTGTTCGGTCCTGAGAGTGGACTGTGGTTTGAGCTTGAAGGAGAAAGCGAAAGAGATACTTAGAGATCATTT
TGATGAGTGGAAGAGGTTCCCATGCATCAATGTACATCTGCATACTAAGCTCTTAGAGCAATAA