Details for Chinese cabbage Locus Brara.A03382

Position : A01 ( 5`- 27830487 .. 27833249 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03382

Protein [Map View]
MESRDLIQCCDCGCHHSSPRSNNNQFSNNPKVHIENECELLRQTVTSQQQSIQDLYDELEKERNAASSAADESMNVMQRL
QHDKAELQMELRQYKVYAGEKMEHDLQEILALEEVVSQREQTILALECEAQGYKHRMMSYGITEGEANGDMSLVDAYDYD
YEYEYPSLKCNINENQDSLGADVYVADDENYPPADSPRGRVHLRSLDQRISQIETNPSLDGGFRVASEKDDVFVESENYK
HVSYTENDDNAKGGGESLDIGDEMSDRVYTIDSGHHGGVTEQKVEVGNVEQVEHGDPDITKLYMRLQALEADRESMKEAL
LSMRTEKAQMVLLKELAQHLSKEVVPQRRLPLRKTSADGTLTFTPVFKWITSFVSWRRKARRSKYMYGMSTNSMGLQMVL
EKVPRSRNWRCLRSTQV*

DNA
ATGGAATCGAGAGATCTAATCCAATGCTGCGACTGTGGATGCCACCATTCCTCTCCACGCTCTAACAACAACCAATTCTC
TAACAATCCCAAAGTCCACATCGAGAACGAATGCGAATTGCTTCGCCAAACAGTCACATCTCAACAACAATCGATCCAAG
ACCTCTACGACGAGCTCGAAAAGGAGCGCAACGCGGCTTCCTCGGCCGCGGACGAGTCCATGAACGTGATGCAGAGGCTG
CAGCACGACAAGGCCGAGCTTCAGATGGAGCTCAGGCAGTACAAGGTTTACGCCGGGGAGAAGATGGAGCACGACCTTCA
AGAGATCTTGGCCTTGGAGGAGGTGGTTAGTCAAAGAGAGCAGACGATCTTGGCTCTTGAGTGCGAAGCTCAGGGCTATA
AGCATAGGATGATGAGTTATGGGATCACTGAGGGAGAAGCTAATGGTGACATGAGCTTGGTTGATGCTTATGATTATGAT
TATGAATATGAGTATCCTTCTTTGAAGTGTAATATAAATGAGAATCAAGATTCTTTAGGTGCTGATGTTTATGTTGCTGA
TGATGAGAACTATCCACCTGCGGATTCGCCACGTGGGAGAGTTCATTTGAGGAGTTTGGATCAAAGAATCAGCCAGATCG
AGACGAATCCTAGCCTGGATGGTGGTTTCAGGGTTGCTTCAGAGAAGGATGATGTTTTTGTTGAATCTGAAAACTACAAA
CATGTCTCGTATACAGAGAATGATGATAATGCTAAAGGAGGTGGTGAGTCATTGGATATAGGAGATGAGATGAGTGATAG
AGTTTATACTATTGACTCTGGCCATCACGGCGGCGTGACTGAACAGAAGGTGGAGGTTGGGAATGTGGAACAAGTGGAGC
ACGGTGATCCTGATATAACGAAGCTCTACATGAGGCTGCAGGCGCTGGAGGCTGACAGGGAGTCTATGAAAGAAGCGCTT
CTTTCTATGAGGACTGAGAAGGCTCAGATGGTGCTGTTGAAAGAACTCGCTCAGCATTTGTCGAAGGAAGTTGTGCCTCA
ACGGAGGTTGCCTTTAAGGAAAACATCCGCTGATGGGACATTGACTTTTACGCCTGTCTTTAAGTGGATCACATCTTTTG
TTTCCTGGAGAAGAAAGGCTCGTCGAAGCAAGTACATGTATGGGATGTCAACAAACAGCATGGGTCTGCAAATGGTTCTA
GAAAAGGTCCCTCGATCACGGAATTGGCGATGTCTCAGGAGCACACAAGTGTGA