Details for Chinese cabbage Locus Brara.A03381

Position : A01 ( 5`- 27821916 .. 27830376 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03381

Protein [Map View]
MTLMTTPPIDQQEDEEMLVPHSDLVEEGPQPMEVAQPEAAAATTVENPPAEEIPTLKFTWSTQGFTRLNVRKLYSDVFVV
GGYKWRILIFPKGNNVDHLSMYLDVADAASLPYGWSRYSQFSLAVVNQMNSKYSIRKETQHQFNARESDWGFTSFMPLSE
LYDPTRGYLVNDTLQIEAEVAVRKVLDYWSYDSKKETGFVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTTENDAPT
ASIPLALQSLFYKLQYNDTRVGTKELTKSFGWDTNDSFMQHDVQELNRILSEKLEDKMKGTVVEGTIQKLFEGHHMNYIE
CINVDYKSTRKESFYDLQLDVKGCKDVYASFDKYVEVERLEGDNKYQAEGHGLQDAKKGVLFIDFPPVLQLQLKRFEYDF
MRDTMVKINDRYEFPLQLDLDRENGKYLSPDADKSVRNLYTLHSVLVHSGGVHGGHYYAFIRPTLSDQWYKFDDERVTKE
VVNRALEEQYGGEEELPQNNPGVNNPPIKFTKYSNAYMLVYIRECDKDKIICNVDEKDIAEHLQVRLKKEQEEKEDKKNY
KAQAHLFTTIKVARDEDITEQIGKSMYFDLVDHEKVRSFRIQKQTPFQQFKEEMAKEFGVPVQLQRYWIWAKRQNHTYRP
NRPLLPHEEQQTVGQIREASNKANNAELKLFLEIERGSDERPIPPPDKSPEDILLFFKLYDPENEELRYVGRLMVKSSSK
PMDIVGQLNQMAGFAPDEEIELYEEIKFEPCVLCEHLDKKTSFRLSQIENGDIICYQKPISIQENECPYPDVPSFLEYVH
NREVVRFRALEKPKEDEFTMELSKLHTYDDVVERLAEKLGLSDSSKIRLTSHNCYSQQPKPQPIKYRGADLSDMLAHYNQ
ASDILYYEVLDIPLPELQRLKILKVAFHHATKDEVVIHNIRLPKQSTVGDVINELKTKVELSHPDAELRLLEVFYHKIYK
IFPPTERIENINDQYWTLRAEEIPEEEKNIGPNDRLIHVYHFTKEAAQNQQVQNFGDPFFLVIHEGETLEDIKTRIQKKL
RVPDEDFAKWKFASFSMGRPDYLQDTDVVYDRFQKQRKDVYGAWEQYLGLEHVDNTPKRAYAANQNRHAYEKPMKIYN*

DNA
ATGACTCTGATGACTACGCCGCCGATAGATCAGCAAGAGGACGAGGAGATGCTCGTTCCGCACTCTGATTTGGTCGAAGA
AGGACCTCAGCCTATGGAAGTTGCTCAGCCTGAGGCGGCTGCTGCTACCACTGTGGAGAATCCACCAGCCGAGGAGATTC
CCACTCTGAAATTCACGTGGAGCACCCAGGGTTTCACCAGGCTTAACGTTAGGAAGCTTTACTCTGATGTATTTGTTGTT
GGAGGTTATAAATGGAGAATATTGATTTTTCCGAAAGGAAACAATGTTGACCATTTGTCCATGTACTTGGACGTTGCTGA
CGCTGCGAGTTTGCCTTACGGGTGGAGCAGATACTCTCAGTTCAGCCTGGCTGTAGTGAATCAAATGAACAGCAAATATT
CCATCAGAAAAGAGACCCAACATCAATTCAATGCAAGAGAAAGCGATTGGGGGTTTACATCATTCATGCCTCTCAGCGAG
CTCTATGATCCCACTCGTGGATATTTGGTGAATGATACTCTTCAGATTGAAGCTGAAGTTGCTGTGCGGAAGGTTCTTGA
TTACTGGTCATATGACTCCAAAAAAGAGACTGGTTTTGTTGGACTTAAGAACCAAGGTGCTACCTGTTACATGAATTCTC
TCCTGCAGACGTTATACCACATTCCTTACTTCAGAAAGGCTGTTTACCACATGCCAACAACTGAGAATGATGCACCCACG
GCTAGTATCCCATTGGCGCTCCAGAGCTTGTTTTACAAGCTTCAGTATAATGACACCCGTGTAGGGACAAAGGAGCTGAC
AAAGTCTTTTGGTTGGGATACAAATGATTCATTCATGCAACATGATGTTCAAGAACTCAACCGAATTCTCTCTGAAAAGC
TTGAGGACAAAATGAAGGGAACTGTTGTGGAGGGAACAATACAGAAGCTATTTGAGGGTCACCACATGAATTACATTGAG
TGCATTAATGTCGATTACAAATCTACACGTAAAGAATCATTCTATGACCTCCAGCTTGATGTTAAAGGCTGCAAAGATGT
ATATGCTTCTTTTGACAAGTACGTTGAAGTTGAACGCCTTGAAGGAGACAACAAATACCAGGCAGAAGGACATGGTTTGC
AGGATGCGAAAAAAGGTGTTCTATTCATTGACTTTCCACCCGTACTTCAACTTCAGCTCAAGAGGTTTGAATATGATTTT
ATGCGAGACACAATGGTGAAGATAAACGATCGATATGAGTTTCCTCTTCAACTGGACCTCGACAGAGAGAATGGAAAATA
CCTATCTCCTGATGCTGACAAGAGTGTTCGTAATCTCTACACACTCCATAGTGTCTTAGTCCATAGTGGAGGAGTGCATG
GAGGGCACTATTATGCTTTTATTAGGCCAACACTCTCAGATCAATGGTATAAATTTGATGATGAACGAGTAACGAAGGAA
GTTGTGAACAGGGCACTGGAAGAGCAATATGGGGGTGAAGAAGAGTTGCCGCAAAATAATCCGGGTGTCAATAATCCACC
TATTAAATTCACAAAGTATTCCAACGCATACATGCTTGTTTATATCCGTGAATGCGACAAGGATAAAATAATATGCAACG
TTGATGAAAAAGACATTGCAGAACATTTACAGGTGAGGCTGAAAAAAGAACAAGAAGAAAAGGAAGATAAAAAAAATTAT
AAGGCTCAAGCTCACCTTTTCACGACAATCAAGGTCGCAAGAGATGAAGACATCACCGAGCAAATTGGAAAGAGTATGTA
TTTTGATCTTGTTGATCATGAAAAAGTTCGGAGTTTTCGAATCCAGAAACAGACTCCCTTCCAACAATTTAAGGAAGAGA
TGGCCAAAGAATTTGGTGTCCCGGTTCAGCTTCAGCGGTACTGGATTTGGGCAAAGCGGCAAAACCATACTTATCGTCCC
AACCGTCCCTTATTACCTCATGAAGAACAACAGACGGTTGGACAAATAAGAGAGGCATCTAACAAGGCAAACAATGCTGA
ACTAAAGCTGTTTTTGGAAATAGAGCGTGGATCGGATGAGCGTCCGATTCCTCCCCCAGACAAGTCACCTGAAGACATTC
TCCTTTTCTTTAAGCTCTATGACCCTGAGAATGAAGAACTAAGATATGTTGGAAGGCTCATGGTGAAAAGTTCCAGTAAG
CCCATGGATATAGTAGGGCAACTGAATCAAATGGCTGGCTTTGCTCCTGACGAGGAAATAGAACTTTATGAGGAAATAAA
GTTTGAACCTTGTGTACTGTGCGAACATCTAGATAAGAAGACTTCTTTCAGACTATCTCAAATTGAAAATGGAGATATCA
TTTGCTATCAGAAACCTATTTCTATCCAGGAGAATGAATGTCCATACCCGGATGTGCCATCGTTTTTGGAGTACGTACAT
AATCGAGAGGTGGTGCGTTTTCGTGCTCTGGAAAAACCAAAAGAAGATGAGTTTACAATGGAGTTGTCAAAGCTGCATAC
GTATGATGATGTTGTGGAAAGATTGGCTGAGAAACTTGGCCTTTCTGATTCATCGAAAATTAGGCTTACTTCTCACAATT
GCTACTCCCAGCAACCCAAGCCTCAGCCTATCAAATACCGTGGCGCAGACCTTTCAGATATGTTAGCTCATTATAATCAG
GCGTCTGACATTTTGTATTATGAAGTTCTGGACATTCCTCTTCCAGAACTTCAACGTCTTAAGATTCTAAAAGTTGCTTT
CCATCATGCCACAAAGGACGAAGTGGTAATCCACAATATCAGACTGCCTAAGCAGAGTACTGTCGGAGATGTTATTAACG
AACTTAAAACAAAGGTGGAGCTTTCACATCCAGATGCAGAACTGAGGTTGCTCGAGGTGTTTTACCACAAGATCTACAAG
ATCTTTCCACCTACCGAAAGAATTGAGAATATCAATGACCAGTACTGGACTTTACGAGCAGAGGAGATACCTGAGGAAGA
GAAGAATATCGGCCCCAATGATCGACTAATTCACGTGTACCATTTTACGAAAGAGGCCGCACAGAATCAGCAAGTGCAAA
ATTTCGGAGATCCATTCTTTTTGGTAATACACGAAGGTGAAACTTTAGAAGACATCAAGACCCGTATCCAAAAGAAACTC
CGTGTCCCTGATGAGGACTTTGCCAAGTGGAAGTTTGCTTCATTTTCGATGGGACGACCTGACTACTTGCAGGACACAGA
TGTTGTTTATGATCGCTTTCAGAAACAGAGAAAGGATGTATATGGTGCATGGGAGCAGTATCTTGGGTTGGAGCACGTTG
ATAATACTCCTAAAAGGGCTTATGCTGCAAATCAGAATCGGCACGCATATGAGAAGCCGATGAAAATATACAACTAG