Details for Chinese cabbage Locus Brara.A03380

Position : A01 ( 5`- 27816411 .. 27820140 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03380

Protein [Map View]
MKETSNNGHEKTLPPHPDLPKLEPPRGTRVSSEEATHQSSFTVDMMKLIRQSRNAISKRISILHENGAVSKKDLNESDVA
EFEISGVKVLVKLKSEEEIRGRVAFFSRSNCRDSTAVRSFLRERGFDFSEINIDVYAHRERELVERTGSSQVPQIFFNEK
HFGGLMALNWLRNSGEFDRRIKELLAEKCCGDAPAPVMYGFDEDEGGGVDEMMSFVRVLRQKLPIKDRLMKMKIVKNCFS
GAEVVEILIHHLDCGRKQAVEIGKKLAKKHFIHHVFGENDFEDGTHYYRLLEHEPFISNCYNFRGSTNDMEPQDAVMVGQ
KLFKIMTAILESYSSDDHSRVDYMRISQSEEFRRYLNLAQDLQRLNLLELSTNEKLAFFLNLYNAMVIHALIRIGRSDGM
IARRSYFTDFQYVVGGYSYSLNSIRNNIIRGGHRQSYAFIKPFMRGGNTHHKLGHPKLNPLVHFGLCDGTKSSPVVRFFT
PQGVEAELKQAAREFFRNGGIDVVLHKRVVHLSRIIKWYKEDFSEGKKLLKWIMSYVDANKAGLLTHLLGEDGGGSVHIV
YQDYDWSINS*

DNA
ATGAAGGAAACCTCAAACAACGGTCACGAGAAGACTCTCCCGCCTCATCCTGACCTACCGAAACTCGAACCGCCACGTGG
CACTCGCGTCTCGTCAGAAGAAGCGACGCATCAGTCATCATTCACCGTCGATATGATGAAACTCATCCGTCAAAGCCGTA
ACGCGATCTCCAAACGTATATCGATTCTACACGAGAACGGCGCCGTTTCGAAGAAGGATCTCAACGAATCCGACGTGGCG
GAGTTCGAAATCTCCGGAGTCAAGGTCCTCGTGAAGCTGAAAAGCGAAGAGGAGATCAGAGGCCGAGTCGCTTTCTTCTC
GAGATCTAACTGCCGAGACTCCACCGCCGTCCGATCGTTTCTCCGGGAACGAGGCTTCGATTTCTCGGAGATCAACATCG
ACGTCTACGCGCACAGAGAGCGCGAGCTGGTCGAGAGAACAGGGAGCTCTCAGGTCCCTCAGATCTTCTTCAACGAGAAA
CACTTCGGCGGATTGATGGCGTTGAATTGGCTGAGAAACAGCGGAGAGTTCGATCGGAGGATCAAGGAGTTGCTGGCGGA
GAAGTGCTGCGGCGATGCGCCGGCGCCGGTGATGTACGGTTTCGACGAGGATGAGGGCGGTGGGGTGGATGAGATGATGA
GTTTCGTTAGGGTTTTGAGGCAGAAGCTGCCGATTAAGGATCGGTTGATGAAGATGAAGATCGTCAAAAACTGTTTCTCC
GGCGCCGAGGTGGTGGAGATATTGATTCATCACTTGGATTGCGGGAGGAAGCAGGCCGTCGAAATTGGCAAGAAACTAGC
CAAGAAACACTTTATCCACCATGTCTTTGGAGAAAATGACTTTGAAGACGGAACCCATTACTACCGTCTCCTTGAGCACG
AGCCATTTATTTCAAACTGTTACAATTTTAGAGGCTCTACAAATGACATGGAGCCCCAAGATGCAGTAATGGTTGGTCAG
AAGCTATTCAAAATCATGACTGCTATTCTCGAGTCTTATTCGTCTGATGACCATTCTCGTGTTGATTACATGAGAATCAG
TCAAAGTGAAGAATTTCGAAGGTACTTGAATTTGGCTCAAGATCTTCAACGGTTGAATCTTCTTGAACTCTCAACAAACG
AGAAATTGGCATTTTTCTTGAATTTGTACAACGCAATGGTGATCCATGCTTTGATCAGAATCGGACGTTCCGATGGAATG
ATTGCAAGAAGATCCTACTTCACGGACTTTCAGTACGTCGTAGGAGGCTACTCTTATTCCCTTAACTCCATAAGAAACAA
CATCATTCGAGGCGGTCATAGACAGTCTTATGCATTTATCAAACCGTTTATGAGAGGCGGTAACACACATCATAAGCTTG
GTCATCCAAAACTTAATCCACTAGTACATTTTGGGCTTTGTGATGGGACCAAATCCAGTCCAGTGGTGAGGTTTTTCACA
CCGCAAGGAGTTGAAGCTGAGCTCAAACAAGCAGCTAGAGAATTTTTCCGAAACGGTGGAATTGACGTTGTCTTGCACAA
GAGAGTCGTTCATCTATCAAGAATCATCAAGTGGTATAAGGAGGATTTCAGTGAAGGGAAGAAATTGTTGAAGTGGATAA
TGAGTTATGTAGATGCAAACAAAGCAGGTCTTTTAACCCATCTTCTCGGTGAGGATGGAGGAGGTTCTGTTCACATCGTC
TACCAAGACTATGATTGGTCTATCAACAGTTGA