Details for Chinese cabbage Locus Brara.A03378

Position : A01 ( 5`- 27802054 .. 27803504 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03378

Protein [Map View]
MAEDQAAAVKETSAVEKQPETTGAEAPTVTITKRMMVAIDESDSSFYALQWVIDHFSNLLMTTEAAEAEGGLLTVVHVQS
PSHHFAAFPAGPGGATAVYASSSMIESVKKAQQEASAALLSRALQMCRAKQIRTETLVLEGEAKDMICQAVEQMHVDLLV
VGSRGLGKIKRAFIGSVSDYCAHHANCPILIVKPPKEITT*

DNA
ATGGCGGAGGATCAAGCAGCGGCGGTGAAGGAAACATCGGCCGTGGAGAAGCAGCCGGAGACGACAGGAGCTGAAGCACC
GACAGTGACAATAACAAAAAGGATGATGGTTGCTATCGACGAGAGTGATTCGAGCTTCTATGCTCTGCAATGGGTCATTG
ACCATTTCTCTAACCTTTTAATGACCACTGAGGCGGCTGAAGCGGAAGGTGGCTTGCTCACGGTGGTTCATGTGCAGTCT
CCGTCCCATCACTTTGCTGCTTTTCCAGCTGGACCCGGCGGCGCAACAGCAGTCTACGCATCTTCGTCGATGATAGAGTC
AGTGAAAAAAGCACAACAGGAGGCCTCTGCAGCCCTTCTCTCGCGTGCACTCCAAATGTGCCGAGCCAAGCAGATACGTA
CTGAAACTCTGGTACTTGAAGGCGAGGCAAAGGACATGATTTGCCAGGCGGTGGAGCAAATGCACGTTGATCTTCTCGTT
GTGGGTAGTCGTGGCCTTGGCAAGATCAAAAGAGCGTTTATTGGGAGCGTTAGCGACTACTGTGCTCATCACGCCAACTG
TCCCATCCTTATTGTGAAGCCACCAAAGGAGATAACTACTTAA