Details for Chinese cabbage Locus Brara.A03371

Position : A01 ( 5`- 27756034 .. 27757219 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03371

Protein [Map View]
MVMKGKVVVQEKVRVYGEAMAKGGRCRDELESKKVAPKGKEKPSGLPVVSDAKESKVVKEKKGKTKEGFKTISMTEKFSC
RGKDLYEILMDENRWKGFTQSNAKISRDVTGAISLFDGSVTGMNLELEEGKLIVQNWRFGSWPDGLDSTVTITFEEPESG
VTIVNLTHTDVPEEDRYGNATVVENTERGWRDLIFHRIRAVFGFGI*

DNA
ATGGTGATGAAGGGGAAGGTGGTTGTTCAGGAGAAGGTTAGAGTTTACGGGGAGGCAATGGCGAAAGGAGGGCGGTGTAG
GGATGAGTTGGAGTCTAAGAAGGTTGCCCCAAAGGGGAAGGAGAAGCCTAGTGGTTTACCGGTTGTATCTGATGCAAAGG
AGAGTAAGGTAGTGAAGGAGAAGAAGGGGAAGACGAAGGAAGGGTTTAAGACGATTAGTATGACCGAGAAGTTTAGTTGT
AGAGGGAAAGATCTGTATGAGATTTTGATGGATGAGAATCGTTGGAAGGGGTTCACGCAGAGTAATGCTAAGATTAGTAG
AGATGTGACTGGTGCGATTAGTTTGTTTGATGGGTCGGTTACTGGGATGAATTTGGAGCTGGAAGAAGGGAAGTTGATTG
TTCAGAACTGGAGGTTTGGGAGCTGGCCTGATGGTCTTGATTCAACGGTAACGATCACTTTCGAGGAACCTGAATCAGGA
GTCACCATTGTTAATCTTACCCACACTGACGTTCCTGAAGAAGACAGATACGGGAATGCGACTGTGGTAGAAAACACAGA
GAGAGGATGGAGAGACCTTATATTCCACAGGATCCGTGCTGTTTTTGGGTTTGGAATATGA