Details for Chinese cabbage Locus Brara.A03369

Position : A01 ( 5`- 27740115 .. 27741341 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03369

Protein [Map View]
MYRFSNTVIGVINLLSLLASIPIKGTALWKARSSKTCENFLQTPLLVIGFIILLVSLAGFIGACFNVAWALWVYLVVMIF
LIATLMGLTLFGLVVTSQGGGVVRDQEYWNSIRSCILTSKTCSKIESWTTLDYFQRDMTSVQSGCCKPPTACTYETGVIV
GGEDCYRWNNGIETLCYECDACKAGVLEEIRLDWRKLSVVNIRLRCRWRWWHEKKEQLY*

DNA
ATGTACAGGTTCAGCAACACAGTGATTGGGGTCATAAACCTTCTCAGCTTACTAGCTTCAATACCAATCAAAGGAACTGC
TCTATGGAAGGCAAGAAGCAGTAAAACTTGCGAGAACTTCCTCCAGACACCGCTTCTCGTGATAGGATTCATCATACTGT
TAGTATCCCTTGCTGGTTTCATAGGAGCTTGTTTCAACGTGGCATGGGCTCTGTGGGTGTACTTAGTTGTCATGATCTTC
CTCATAGCGACTCTCATGGGTCTAACGCTCTTTGGTCTTGTGGTGACTAGCCAAGGAGGTGGTGTGGTTAGAGATCAAGA
GTATTGGAACTCCATTAGAAGCTGTATCTTGACTTCAAAGACTTGTTCTAAGATTGAATCTTGGACCACACTTGATTATT
TCCAAAGGGATATGACTTCTGTTCAGTCGGGATGTTGTAAGCCACCAACGGCGTGCACGTACGAGACTGGAGTAATAGTC
GGAGGAGAAGATTGCTATAGATGGAACAATGGTATTGAAACGTTATGCTACGAGTGTGATGCTTGTAAAGCTGGTGTTCT
TGAAGAGATCCGTCTTGACTGGAGAAAGTTATCGGTTGTCAACATCCGTCTACGCTGCAGGTGGAGATGGTGGCATGAAA
AGAAAGAACAGCTTTACTGA