Details for Chinese cabbage Locus Brara.A03367

Position : A01 ( 5`- 27727547 .. 27729818 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03367

Protein [Map View]
MDTRKRAGSFNSNGGGGGFKKSKQEMESYSTGLGSKSKPCTKFFSTSGCPFGDNCHFLHHVPGGYNAVAQLTNMALPMPQ
ASRNMQGPGGGGGGRFSGRGGESGPGHVSSFGASATAKISVDASLAGAIIGKGGVSSKQICRQTGAKLSIQDHERDPNLK
NIELEGTFEQINEASVMVRELIGRLNSAASRRPPGGGGGGIGGGVGSEGKPHPGSNFKTKMCERFAKGNCTFGDRCHFAH
GEAELRRSGVA*

DNA
ATGGATACTCGTAAGAGAGCTGGCTCATTCAACTCCAATGGCGGCGGCGGAGGATTCAAGAAGTCTAAGCAAGAGATGGA
ATCATATTCAACTGGTTTAGGCAGCAAATCCAAGCCTTGCACTAAATTTTTCAGCACTTCTGGCTGTCCTTTTGGAGATA
ACTGCCACTTCTTGCATCACGTTCCCGGAGGATACAATGCTGTAGCACAACTGACAAACATGGCACTACCCATGCCTCAA
GCTTCCAGAAACATGCAAGGACCTGGTGGTGGTGGAGGAGGGAGATTCTCAGGGAGAGGAGGAGAGTCTGGACCTGGCCA
TGTCTCTAGCTTCGGTGCATCAGCCACTGCGAAGATCAGCGTGGACGCTTCGTTGGCCGGGGCCATCATTGGGAAAGGAG
GAGTCAGTTCAAAGCAGATATGTCGTCAGACGGGGGCGAAGCTGTCGATTCAAGATCACGAGAGGGATCCGAACCTGAAG
AACATTGAGCTTGAAGGGACGTTTGAGCAAATAAACGAAGCGAGTGTGATGGTTAGGGAGCTGATTGGGAGGCTTAACTC
TGCAGCTAGTAGGAGACCACCTGGTGGTGGTGGTGGTGGGATTGGTGGTGGGGTTGGTTCAGAAGGGAAACCGCATCCAG
GGAGCAACTTCAAGACGAAGATGTGTGAGAGGTTCGCGAAAGGGAACTGTACGTTTGGGGATAGATGTCACTTTGCGCAC
GGGGAAGCAGAGCTGCGCAGGTCAGGAGTTGCCTAA