Details for Chinese cabbage Locus Brara.A03366

Position : A01 ( 5`- 27722423 .. 27725780 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03366

Protein [Map View]
MEAQIHLLEQEAYTAVLRAFKAQSDAISWDKESLITDLRRELRVSDDEHRELLSRVNKDDTIQRIRDWRQGGGSQVPSRH
ATNQGFDVVPSPTFSASRKKQKPFQSYPSFGAAGNRSFNSRVVPGGISANESAEALIGRKVWTKWPEDNNFYEAIITQYN
AAEGRHALVYDIHAANETWEWVDLKEIPPEDIRWDGEESGVALNAGLGSGSIRGNRRNYQSNIGRGRGPRIHQPRREFLP
TQQNGGGGGGGDRITSSDDIELFNTDSLVKEVERVFDTAHPDPFELDKAKKMLKEHEQALIAAIARLADTSDGELDGDPP
DSHDHPMAQG*

DNA
ATGGAGGCACAAATTCATCTACTTGAGCAGGAAGCATACACCGCTGTTTTAAGGGCTTTTAAAGCGCAGTCTGATGCTAT
TTCTTGGGACAAAGAAAGTCTGATAACAGATTTGCGTAGAGAACTAAGGGTATCTGATGACGAACATCGAGAGCTTCTGA
GCAGGGTCAATAAGGATGATACCATTCAACGGATAAGAGATTGGAGACAGGGAGGCGGAAGCCAAGTCCCTTCTAGACAT
GCAACTAATCAGGGTTTTGATGTTGTTCCTAGTCCAACTTTCTCAGCTTCCCGGAAGAAACAGAAGCCATTTCAATCTTA
TCCATCGTTTGGTGCGGCTGGGAATAGGTCATTCAATAGTCGTGTTGTACCCGGTGGCATTTCAGCAAATGAATCTGCCG
AAGCACTTATCGGAAGAAAAGTGTGGACAAAATGGCCTGAAGACAACAACTTTTATGAAGCAATTATAACCCAGTACAAC
GCAGCTGAGGGTCGGCATGCTTTGGTGTATGATATACACGCAGCAAATGAGACGTGGGAATGGGTTGATCTCAAGGAGAT
TCCTCCGGAAGATATAAGGTGGGATGGAGAGGAGAGTGGGGTAGCTTTAAACGCTGGACTTGGAAGTGGATCAATCCGTG
GCAACAGAAGGAACTACCAAAGCAATATTGGTAGAGGGAGAGGACCAAGAATTCATCAACCGAGAAGAGAATTTTTACCA
ACACAACAGAATGGTGGTGGTGGTGGTGGTGGTGACCGGATAACTTCATCTGATGATATTGAATTGTTCAACACTGATTC
GCTTGTGAAGGAGGTGGAGAGAGTTTTCGATACTGCTCATCCTGATCCTTTTGAGCTTGACAAGGCCAAGAAAATGCTCA
AGGAACATGAACAGGCGCTTATTGCTGCCATAGCAAGGCTTGCGGATACTTCTGATGGTGAGCTCGATGGAGATCCACCA
GATTCGCATGACCATCCAATGGCACAGGGATGA