Details for Chinese cabbage Locus Brara.A03363

Position : A01 ( 5`- 27711046 .. 27712386 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03363

Protein [Map View]
MTLLLHLSIFFTILFISLPSSHSSSSNDKNALLQIKKALNNPPLLSSWNPQTDFCTTWTGVECTNGRVTALTISSGEISG
QIPAQVGDLLELRTLDFSYLTHLTGNIPHTITKLKYLDLLRLKQTNLSGYIPDFISELKSVTFLDLSFNQFTGPIPGSLS
QMPKLDAIQINDNKLTGSIPNSFGSFVGKVPNLYLFNNKLSGKVPESLSKYDFNAVDLSGNSFTGDGSMFFGRNKTTIRV
DLSRNMFEFDLSKVKFARSIVSLDLSHNKIFGKFPRELNKLRLEHFNVSYNHLCGKIPSGGLLQTFEPSAFSHNLCLCGT
PLTAC*

DNA
ATGACGCTCCTTCTTCACCTCTCTATCTTCTTCACCATACTCTTCATCTCTCTCCCATCTTCTCACAGCTCCTCCTCAAA
TGACAAGAATGCCCTCCTCCAAATCAAGAAAGCCTTAAACAACCCTCCACTCCTCTCCTCCTGGAACCCCCAAACCGACT
TCTGCACCACCTGGACCGGCGTCGAGTGCACCAACGGCCGCGTCACCGCTCTCACCATCTCCTCCGGTGAAATATCCGGC
CAGATCCCGGCCCAGGTCGGCGACCTTCTTGAGCTCCGTACGCTTGATTTCAGTTACCTGACTCACCTCACTGGGAACAT
TCCACACACCATCACCAAGCTCAAGTACCTGGACCTCCTCCGGTTAAAGCAGACCAATCTCTCCGGTTATATTCCTGATT
TCATCAGCGAGCTCAAGAGCGTTACGTTTTTAGACCTTTCGTTTAACCAGTTCACGGGTCCAATTCCCGGTTCGCTTTCT
CAGATGCCGAAGCTAGATGCCATTCAGATCAACGACAATAAGTTAACCGGTTCTATACCGAACTCTTTCGGTTCTTTTGT
TGGCAAGGTTCCTAATCTCTACTTGTTTAACAATAAGCTCTCAGGAAAAGTACCAGAATCGTTGTCAAAGTACGACTTTA
ACGCAGTGGATCTGTCGGGAAACAGTTTCACCGGAGATGGTTCGATGTTCTTCGGACGTAACAAAACAACAATACGTGTT
GATCTGTCGAGAAACATGTTTGAGTTTGATCTCTCCAAGGTTAAGTTCGCTAGGAGCATAGTGTCGTTGGATCTGAGCCA
TAACAAAATCTTCGGGAAGTTTCCTAGAGAGCTAAACAAGCTGCGTCTCGAGCATTTCAACGTTAGTTACAATCATCTCT
GCGGAAAAATCCCAAGTGGTGGTCTCCTTCAGACATTTGAACCATCTGCTTTCTCTCACAATCTCTGTCTCTGTGGGACC
CCGCTTACGGCTTGTTGA