Details for Chinese cabbage Locus Brara.A03361

Position : A01 ( 5`- 27705722 .. 27707770 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03361

Protein [Map View]
MENDGGCSSERSLYEVLGVGATATQQEIRKAYHKLALRLHPDKNKDDQEAKEKFQQLQKVISILGDEEKRAVYDQTGSVD
DADLSGDVVDNLRDFFKAMYKKVTEEDIEEFEANYRGSESEKKDLIELYTKFKGKMSRLFCSMLCSDPKLDSHRFKDIID
EAIAAGEVKSTKAYKKWAKEISEIKPPTSPQKMRHKAKKGAETDLHALISQRRDSRKEKFDTMFSSLASRYGSSADTEPN
EEEFEAAKRKVESRVSSKKSRRK*

DNA
ATGGAGAACGATGGGGGATGTAGTAGCGAGAGAAGTCTTTACGAGGTACTTGGAGTGGGAGCAACAGCAACTCAGCAGGA
GATAAGGAAAGCTTACCATAAGTTGGCTTTGAGGCTTCATCCTGACAAAAACAAGGACGACCAGGAAGCTAAAGAGAAAT
TTCAGCAGCTGCAAAAGGTGATTTCGATTCTCGGTGATGAAGAGAAAAGGGCTGTCTATGATCAAACTGGCTCCGTCGAC
GATGCTGATCTCTCGGGAGATGTGGTTGACAACTTGAGGGACTTCTTCAAGGCAATGTACAAGAAGGTCACCGAGGAAGA
TATTGAAGAGTTTGAGGCAAACTACAGAGGTTCTGAGTCTGAGAAGAAAGATTTGATTGAGCTCTACACCAAGTTTAAGG
GTAAAATGAGCAGGCTTTTCTGCTCAATGCTTTGCTCCGACCCCAAGCTTGATTCACACCGTTTCAAAGATATCATCGAT
GAAGCCATTGCAGCAGGAGAAGTGAAGTCAACAAAAGCTTACAAGAAATGGGCAAAGGAAATCTCAGAGATAAAACCTCC
CACTAGTCCCCAAAAGATGAGACACAAGGCTAAAAAGGGCGCAGAGACAGATCTCCACGCTCTAATATCACAGCGAAGAG
ATTCGAGGAAAGAGAAGTTCGATACAATGTTCTCCTCACTTGCCTCCAGGTATGGTAGCAGTGCTGACACAGAGCCAAAC
GAAGAAGAGTTCGAAGCTGCCAAGAGAAAAGTCGAAAGCCGGGTTTCATCAAAGAAGTCAAGAAGAAAGTAA