Details for Chinese cabbage Locus Brara.A03347

Position : A01 ( 5`- 27642135 .. 27642992 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03347

Protein [Map View]
MSSLRRALLVAGKTKINLQNCHFITGINYNGLSVKQLQELRGILRENSNTKLLVAKNTLVFKALEGTKWESLKPCMKGMN
AWIFVQTEDIPAALKTFVSFQKEKKLFDNNLGGAVFEEKLYGPKDYKVIETMPFREDVYGVMFGALHWPGLDLVNTLQAP
SASGDESAA*

DNA
ATGTCCAGCCTTCGAAGAGCTCTCCTCGTGGCGGGGAAGACGAAGATCAACCTCCAGAACTGCCATTTCATCACCGGAAT
CAACTACAACGGCCTCAGCGTGAAGCAGCTACAAGAGCTCCGAGGGATCCTCCGCGAGAACAGCAACACGAAGCTCCTCG
TCGCGAAGAACACTCTGGTCTTCAAGGCCCTGGAAGGAACCAAGTGGGAGTCTCTGAAGCCGTGTATGAAAGGTATGAAC
GCGTGGATCTTCGTGCAGACCGAAGACATCCCCGCGGCTTTGAAGACGTTCGTCAGTTTCCAGAAGGAGAAGAAGTTGTT
CGATAATAACTTGGGAGGTGCTGTGTTCGAGGAGAAGCTGTATGGTCCGAAGGATTATAAGGTTATTGAAACGATGCCGT
TTCGGGAAGATGTGTATGGTGTTATGTTTGGTGCGTTGCATTGGCCGGGGTTGGATCTTGTTAACACGTTGCAGGCACCA
TCTGCGTCGGGGGATGAGAGTGCTGCGTAG