Details for Chinese cabbage Locus Brara.A03335

Position : A01 ( 5`- 27609750 .. 27610875 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03335

Protein [Map View]
MKSSLLLLLIIFSFLLSFSSAEECGRQAGGALCPNNLCCSPFGWCGDTEPYCKRPGCQSQCTPDGHPPPPPPGPPPPPDP
TGGLTDIITRSQFDDMLKHRNDPACPARGFYTYEAFITAAYYFTSFARGRDTAARKKELAAFFGQTSYESTGHPKNSSIY
TWGYCYKEEMNPPSDYCSPSDTWPCVPGKRYYGRGPVLLQGNHEYGAYGQALNADLLNNPDLVSNDPVIAFKVAILFWMK
PVPPKPWSHGVLINLWRPSTADIAAGRLPGYGVITNIFNGRIECGHGYDARVADRIGFYRRYCEILGADPGDNLDCYNQR
PFDPVICPSTLLFNKE*

DNA
ATGAAGTCTTCACTACTTCTCTTACTCATCATCTTCTCGTTTCTTTTATCATTTTCCTCGGCCGAGGAATGTGGTCGACA
AGCGGGAGGTGCTCTCTGCCCCAACAATCTATGCTGCAGCCCGTTCGGATGGTGCGGTGACACCGAACCTTACTGTAAGC
GGCCTGGCTGCCAAAGCCAGTGCACTCCTGATGGTCATCCTCCTCCTCCTCCTCCTGGTCCACCTCCTCCTCCTGATCCC
ACCGGCGGTCTTACTGATATCATTACAAGATCTCAGTTCGACGACATGCTTAAACATAGGAACGACCCCGCTTGTCCCGC
TAGAGGTTTCTACACTTACGAAGCCTTTATCACCGCGGCTTATTACTTCACCAGCTTCGCCAGAGGCAGAGACACTGCCG
CGAGGAAGAAAGAACTCGCCGCTTTCTTTGGTCAGACTTCCTACGAATCCACTGGTCATCCAAAAAACAGTTCAATATAC
ACGTGGGGCTACTGTTACAAGGAAGAGATGAATCCTCCTTCAGACTACTGTTCACCGAGTGACACGTGGCCATGCGTACC
TGGCAAGCGCTACTACGGAAGAGGACCGGTGCTGCTGCAGGGGAACCACGAGTACGGAGCGTACGGACAAGCCCTTAACG
CCGACTTACTCAACAACCCTGACCTTGTCTCTAACGACCCAGTGATAGCTTTCAAAGTCGCGATTTTATTCTGGATGAAA
CCTGTGCCTCCAAAACCGTGGAGCCACGGCGTGTTGATAAATTTATGGAGGCCTTCAACGGCAGACATTGCGGCCGGGAG
ATTACCGGGTTACGGTGTGATAACGAATATCTTCAACGGTAGAATAGAGTGTGGACATGGCTATGACGCAAGAGTTGCTG
ATAGGATTGGGTTTTATAGGAGGTACTGTGAAATCTTAGGAGCTGACCCCGGAGATAATCTTGATTGTTACAACCAACGG
CCATTTGATCCTGTAATTTGTCCCTCGACGCTGCTATTTAATAAAGAGTGA