Details for Chinese cabbage Locus Brara.A03332

Position : A01 ( 5`- 27596435 .. 27598585 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03332

Protein [Map View]
MGETLITTLSMENYHPSTLLSMDSDAFTHEESERETNRSLLLTGPPDINLPLSSEASPSLFLWNEHCDILDVGLGPQIYE
PEAVVHVPKVAKKHNKRVDSAWGAWLFFSFYFKPVLDDKSKNKLMRDSNGLSGYDKSDLQLDSFMVQHDMENMYMWVFKE
KPENALGKMQLRSYMNGHSREGERPFPFSVDKGFVRSHRMQRKHYRGLSNPQCLHGIEVVQSPNLSVLNEDEKKKWTELT
GRDVNFAIPLEAIDYGSWRNLPTTELEAERPMAQAKANGHTHLKKLNGTFMTLSTHSPNHGADSVEAQIACNNKRKRDCL
ALGNCDDSSSSEKSLDMKISTTELLPWSNDFAGVMKDVYGPVTAAKTIYEDDKGYLIIVSLPLVDPERVKVTWRNTPTHG
IVKISCTSTACEPFIKRHDRTFKLTDPTPEHCPPGEFVREVSLPNRIPDDAKLEAYRDETGTTLEVLVPKHRIGPEEHEV
RVCLRPFMLE*

DNA
ATGGGTGAGACTCTCATCACAACTCTGTCTATGGAGAATTATCACCCGTCGACACTACTCTCCATGGACTCCGATGCTTT
TACTCATGAAGAATCTGAGAGGGAGACTAACCGGTCGCTTTTGCTCACGGGTCCTCCTGATATCAACCTCCCGCTCTCAT
CTGAGGCGAGCCCGTCTCTGTTTCTGTGGAACGAGCATTGTGATATCTTAGACGTTGGCCTTGGGCCTCAGATTTATGAG
CCTGAGGCTGTTGTTCATGTCCCCAAGGTTGCTAAGAAGCATAACAAGCGTGTAGATAGTGCTTGGGGTGCTTGGCTTTT
CTTTAGCTTTTACTTCAAGCCTGTTTTGGATGATAAGTCTAAGAACAAGTTGATGAGGGATAGTAATGGGTTGTCTGGGT
ATGATAAATCTGATTTGCAGCTTGACTCCTTCATGGTTCAGCATGATATGGAGAATATGTACATGTGGGTGTTCAAGGAG
AAGCCTGAGAATGCTCTGGGGAAGATGCAGCTAAGGAGTTACATGAACGGCCACTCGCGCGAGGGCGAGCGTCCTTTTCC
TTTTAGTGTGGACAAAGGTTTCGTACGCTCTCATAGGATGCAGAGGAAACACTACCGTGGTCTTTCTAACCCACAGTGTC
TCCATGGGATCGAAGTTGTTCAGTCGCCAAACCTCTCTGTGCTTAACGAGGATGAGAAGAAGAAGTGGACGGAACTCACA
GGTCGAGATGTGAACTTTGCTATTCCCCTTGAGGCAATTGATTACGGTTCGTGGAGGAACCTCCCTACCACGGAACTGGA
GGCTGAGCGACCTATGGCTCAGGCTAAAGCTAACGGGCACACCCACCTTAAAAAGCTCAACGGTACCTTTATGACTCTGT
CAACACATTCACCAAACCATGGAGCTGACTCAGTGGAAGCACAAATCGCTTGCAACAACAAACGCAAAAGGGATTGTCTC
GCTCTAGGAAACTGCGATGACTCAAGCTCAAGTGAGAAGTCTCTGGACATGAAAATCAGCACAACAGAGCTGCTGCCATG
GTCAAATGATTTCGCTGGGGTGATGAAGGATGTGTATGGGCCAGTCACAGCTGCGAAAACCATATACGAAGATGACAAAG
GGTATTTGATAATCGTCAGCCTGCCACTAGTTGATCCGGAAAGGGTGAAAGTGACATGGAGGAACACACCAACTCACGGA
ATAGTGAAGATATCATGTACAAGTACAGCTTGTGAGCCATTCATCAAGAGACATGACAGGACATTTAAGCTAACAGATCC
GACACCAGAGCACTGCCCACCAGGAGAGTTTGTCAGGGAAGTCTCCCTGCCAAACAGGATTCCAGACGACGCCAAGCTTG
AAGCTTACAGGGATGAGACAGGAACAACGCTAGAGGTTTTAGTACCTAAACACCGAATAGGACCAGAGGAGCATGAGGTT
CGCGTCTGTCTCCGTCCCTTTATGTTAGAGTGA