Details for Chinese cabbage Locus Brara.A03330

Position : A01 ( 5`- 27591691 .. 27592642 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03330

Protein [Map View]
MIDDQDLGFIVNSLGIFIFGLVIAYHYVAADPKYEAT*

DNA
ATGATTGATGATCAAGACTTGGGGTTTATAGTCAATTCTCTTGGCATCTTCATCTTCGGATTGGTAATTGCTTATCATTA
CGTAGCTGCTGATCCCAAATACGAAGCCACTTGA