Details for Chinese cabbage Locus Brara.A03329

Position : A01 ( 5`- 27583957 .. 27590881 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03329

Protein [Map View]
MSSSFTPGQNHSPGSSRLLQLGVAGSASRLRSSSSKKPPEPLRRAVADCLSSSHPPATSHHGAIPSIAPSEALRNLRDYL
SATGTTDLAYNMLLEHTIAERDRSPAVVTRCVALLKRYLLRYKPGEETLLQVDKFCVNLIAECDASLKQKSLPVLSAPAG
ASPLPVSSFASAALVKSLHYVRSLVALHIPRRSFQPAAFAGATLASRQLLPSLSSLLSKSFNSQLSPANAVESPQKKDAA
NLSVSNLSNIEEFNAMEDTEYISSDLLNWRWVGELQFSSASSESERLVNLQDMNNCNLLEVGAAGLLVGDMEAKMKGQHW
KYFGTAEMPYLEQLLQPASVTMITNSASARSHLRAITASKRTRTGPQQIWDDSTVSTFRPRARPLFQYRHYSEQQPLRLN
PAEVGEVIAAVCSEASSTPSNPMTVSPQLNSKTGKPSMDVAVSVLIKLVIDMYEVVHSKLICIMTNMFYRSPELDGSAKA
TSRASNFLVEQVDLIGGVEFIFYKYSLATTREERRNLYSVLFDYVLHQINEACSVAGLSEYTDDEIQPLAVRLALADAPE
AFYISFGLFQRMMTEEPENYQNMLQKLVFKAQQSNNEKLLENPYLQMCGILQLSNEL*

DNA
ATGTCTTCCTCGTTCACCCCCGGTCAAAATCACAGCCCCGGAAGCTCCCGGCTGCTCCAGCTCGGGGTCGCCGGCTCCGC
CTCCCGCCTTAGATCTTCTTCCTCCAAGAAGCCCCCCGAGCCGCTGCGCCGAGCCGTGGCGGATTGCCTCTCGTCCTCCC
ACCCTCCGGCTACGTCTCACCACGGCGCGATCCCTTCGATAGCACCGTCCGAAGCTCTTAGGAATCTCAGGGATTATTTA
TCAGCCACTGGCACGACTGACCTGGCCTACAACATGCTGTTAGAGCATACTATAGCAGAGAGAGATCGCAGTCCGGCTGT
GGTGACGAGGTGTGTGGCATTACTGAAACGGTATCTCTTAAGGTATAAGCCTGGGGAGGAGACACTGCTGCAGGTTGATA
AATTTTGCGTGAACCTGATTGCTGAATGCGATGCTAGCTTGAAGCAAAAATCATTGCCTGTTTTATCAGCACCAGCGGGT
GCTTCTCCTTTACCTGTGTCCAGTTTTGCTTCTGCAGCTTTGGTGAAGTCATTGCATTATGTGCGTTCTCTTGTGGCACT
ACATATCCCAAGGCGATCCTTTCAACCAGCGGCATTTGCCGGAGCTACTCTTGCATCAAGACAGTTATTGCCATCTCTAT
CTTCTTTGTTGAGCAAATCATTCAATTCTCAATTAAGTCCTGCAAATGCCGTAGAGTCTCCTCAGAAAAAGGATGCTGCA
AATCTGTCTGTTTCAAACTTGTCAAATATAGAAGAATTTAATGCTATGGAAGACACTGAGTACATATCATCAGACTTACT
GAACTGGCGTTGGGTTGGGGAGCTCCAGTTTTCATCAGCTTCTTCTGAAAGCGAACGCCTTGTGAATCTCCAAGACATGA
ACAATTGTAATCTCTTGGAAGTTGGTGCTGCGGGCCTGCTCGTAGGAGATATGGAAGCTAAAATGAAGGGCCAACACTGG
AAATATTTTGGTACCGCAGAGATGCCTTACTTAGAACAGCTGCTGCAGCCAGCATCAGTCACAATGATAACAAACTCAGC
CTCAGCTCGTTCCCATTTGAGAGCGATAACAGCTTCCAAACGCACTAGAACTGGCCCTCAGCAGATCTGGGATGATTCCA
CAGTGAGCACATTTCGTCCACGTGCCAGACCACTTTTTCAGTATCGTCATTACAGTGAACAACAACCACTGCGCCTAAAC
CCTGCCGAGGTAGGTGAGGTGATCGCTGCTGTTTGTTCCGAGGCATCATCCACCCCTTCAAATCCAATGACCGTATCACC
CCAATTAAATAGCAAGACTGGGAAGCCGTCAATGGATGTGGCTGTGAGCGTCCTGATAAAGCTTGTAATTGACATGTACG
AAGTTGTTCATTCCAAGCTTATTTGTATCATGACAAACATGTTTTATCGATCTCCAGAACTAGATGGCTCTGCCAAAGCA
ACTTCAAGAGCCTCAAATTTTCTTGTAGAACAGGTCGATCTGATTGGTGGCGTGGAGTTCATTTTCTATAAGTACTCTTT
GGCAACAACTAGAGAGGAAAGAAGAAATCTCTACTCAGTTTTATTTGACTATGTCTTGCATCAAATTAATGAGGCATGCT
CAGTCGCTGGTCTTTCTGAGTACACTGATGATGAGATTCAACCTTTGGCTGTTCGACTTGCTCTTGCTGATGCACCTGAA
GCTTTCTACATTTCTTTTGGGTTATTTCAGAGGATGATGACGGAGGAACCAGAAAATTACCAAAACATGCTTCAGAAGCT
TGTCTTTAAGGCTCAGCAGAGCAATAATGAGAAACTGCTGGAGAATCCATACCTGCAGATGTGTGGTATACTCCAGCTAT
CAAACGAGCTTTAA