Details for Chinese cabbage Locus Brara.A03328

Position : A01 ( 5`- 27579707 .. 27581080 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03328

Protein [Map View]
MCELVARTGRLQQRYKDGSRLVAGCIPFRYINSDENDSNGSGKVVQVLMISSSSGPGLLFPKGGWENDETVKEAAVREAV
EEAGVRGILMDFLGDYEFKSKTHQDECSPEGLCKAAMYALYVKEELETWPEQKTRTRTWLTIGEAVENCRHAWMKDALVD
GFCKWHKEKIGKGDED*

DNA
ATGTGTGAATTAGTCGCGCGTACGGGTCGGCTCCAGCAACGGTACAAGGATGGCTCGCGTCTCGTAGCTGGGTGTATTCC
TTTTAGGTATATAAACTCTGACGAAAATGATAGTAATGGATCTGGGAAAGTAGTTCAAGTGTTGATGATCAGCTCATCTA
GTGGACCCGGACTTTTGTTTCCCAAGGGAGGATGGGAGAATGATGAAACAGTCAAAGAAGCTGCAGTAAGGGAAGCTGTG
GAAGAAGCAGGAGTCCGTGGGATTCTTATGGATTTTTTGGGAGACTATGAGTTCAAGAGCAAAACGCACCAAGATGAGTG
TAGCCCAGAAGGTTTATGTAAAGCTGCAATGTACGCCTTGTATGTGAAGGAAGAGCTGGAGACTTGGCCGGAACAGAAGA
CGAGAACGAGGACATGGCTTACAATTGGAGAAGCTGTAGAGAATTGCAGGCACGCTTGGATGAAGGATGCCTTGGTTGAT
GGGTTCTGTAAATGGCATAAGGAGAAGATTGGCAAAGGAGATGAAGATTGA