Details for Chinese cabbage Locus Brara.A03323

Position : A01 ( 5`- 27565519 .. 27566310 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03323

Protein [Map View]
MSSTSASLTLFFFFFASTFLYANAFNITRILNLNNEFSTFNNLLSQTGLASTINSRQTITVLALSNDAMSIFSDQSTEDN
KKSLSLHVVLDYYDIKKLKSLNKKSVILTTLFQSSGQAKGQQGFINATVMNNGDVMFGSAVRGSLLDSKLIDSVATHPYN
ISVLHISSYIPIMNPEGPSDHGSSSTPLPPQPPNDDDYTFDEPPSPPSSTTKPFVAAATAATAKPPSAAKANSTTSGVSA
INAPDLAFAFAFVISSFWFFMTV*

DNA
ATGTCTTCTACTTCTGCTTCACTTACACTCTTCTTCTTCTTCTTTGCTTCTACATTCCTCTACGCCAACGCATTCAACAT
CACACGCATCTTAAACCTGAACAATGAGTTCTCCACTTTCAACAACCTCCTCTCCCAAACCGGGCTCGCTTCCACCATCA
ACTCCCGTCAAACCATAACCGTCCTCGCCCTTTCCAACGACGCAATGTCCATATTCTCCGACCAATCAACCGAAGACAAC
AAGAAAAGCCTCAGCCTCCACGTCGTTTTAGATTACTACGACATCAAGAAACTCAAGAGTCTCAACAAAAAATCAGTAAT
ACTCACCACTCTCTTCCAATCAAGCGGTCAAGCCAAAGGCCAACAAGGGTTCATAAACGCAACCGTTATGAACAATGGTG
ACGTCATGTTTGGGTCTGCGGTTCGTGGATCTCTCCTTGACTCTAAGCTTATAGACTCTGTTGCCACACATCCATATAAC
ATCTCGGTGCTTCATATTAGTAGTTACATACCTATAATGAATCCTGAAGGTCCTTCTGATCATGGTTCATCATCTACACC
ACTTCCTCCACAACCTCCTAATGATGATGATTATACATTTGACGAGCCACCATCCCCACCATCCTCCACTACTAAGCCTT
TTGTTGCTGCTGCTACTGCCGCTACTGCTAAGCCACCTTCTGCTGCAAAAGCCAACTCAACAACAAGTGGAGTTTCAGCG
ATTAATGCTCCTGACTTGGCGTTTGCGTTTGCGTTTGTGATCTCATCCTTTTGGTTCTTCATGACGGTCTAA