Details for Chinese cabbage Locus Brara.A03315

Position : A01 ( 5`- 27491635 .. 27493403 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03315

Protein [Map View]
MMQSREERRSESPSGLVLTTDPKPRLRWTAELHERFVDAVTHLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRLGKQ
PHKDHSHGHSTNIRDPNRVSMLDLQRNVVFTTPHITGHNMNEMQTEVHRRIEEEVELERQVNQRIEAQGKYMESMLEKAC
ETQEASLTKDYSTLFFDRTTICNNSSPLTIQWFEDQFPSSSSMDSAMHLPDINSNFSLQDSRSSITKNHTVCLG*

DNA
ATGATGCAGTCAAGGGAAGAGAGGAGATCTGAGTCACCATCAGGTCTTGTACTGACCACCGATCCTAAGCCTCGCCTTCG
TTGGACCGCCGAGCTTCATGAACGCTTCGTTGACGCTGTTACTCACCTTGGAGGCCCTGACAAGGCTACACCTAAGACGA
TAATGAGAGTGATGGGCGTGAAGGGTCTTACACTTTACCATCTCAAGAGCCATCTCCAGAAGTTCAGACTTGGAAAGCAG
CCTCACAAGGACCATAGCCATGGTCACTCCACTAATATTAGGGATCCTAATAGAGTTTCCATGTTGGATCTTCAAAGGAA
TGTTGTATTCACTACTCCCCATATCACTGGTCACAATATGAATGAGATGCAAACTGAAGTGCACAGAAGAATAGAGGAAG
AGGTAGAATTAGAAAGACAGGTAAATCAAAGGATAGAAGCACAAGGGAAATACATGGAGAGCATGCTAGAGAAAGCATGT
GAGACACAAGAAGCAAGCCTTACCAAAGACTACTCTACTCTCTTTTTCGACCGAACCACTATTTGCAACAACTCATCACC
CCTCACAATCCAATGGTTCGAGGATCAGTTTCCTTCGTCTTCCTCTATGGACTCTGCAATGCATCTCCCTGACATCAATT
CCAACTTCTCCCTCCAAGATTCTCGGAGTTCCATCACCAAAAACCATACGGTTTGCCTCGGTTAA