Details for Chinese cabbage Locus Brara.A03314

Position : A01 ( 5`- 27488693 .. 27490886 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03314

Protein [Map View]
MHKLSRTNHDKLQQFVSITGASENSALQALKASDWQIEAAFDVFYSQPQPKSNGDMRRLEELFNRYKDPYSDMILAEGVS
VLCSDLQVEPQDIVTLVLSWHMNAATACEFSREEFVGGLQALGVDSIGKLQEKLAFMRSELKDEQKFYDIYSFAFGWAKE
KGQKSLALDTAIGMWQLLFAEKEWPLVNHWCDFLQDRHNKAISKDTWAQLLEFARTVNPMLSNYDAEGAWPYLIDEFVEY
LYDKSVVDK*

DNA
ATGCATAAGTTGAGTAGAACCAACCATGACAAGCTTCAGCAGTTCGTGTCTATTACAGGAGCTAGTGAGAATAGTGCTCT
TCAGGCTCTTAAAGCCAGTGATTGGCAGATCGAAGCAGCTTTTGATGTGTTTTACAGTCAGCCACAGCCGAAAAGCAATG
GTGATATGAGACGCTTGGAAGAGCTCTTCAATAGATATAAAGATCCATATTCTGATATGATTCTAGCGGAAGGTGTCTCG
GTTCTCTGTAGTGATCTTCAGGTGGAACCTCAAGACATTGTCACGTTGGTTCTTTCGTGGCATATGAATGCTGCCACAGC
GTGTGAATTTTCCAGGGAAGAATTTGTTGGTGGATTACAAGCATTAGGCGTAGATTCCATTGGGAAGTTGCAGGAAAAGC
TGGCATTTATGCGTTCTGAGCTTAAAGATGAACAAAAGTTTTATGACATCTACAGCTTTGCTTTTGGGTGGGCGAAAGAG
AAGGGGCAGAAGTCTCTTGCTTTAGATACAGCGATTGGGATGTGGCAGCTGCTCTTTGCAGAAAAAGAGTGGCCTTTGGT
GAATCACTGGTGTGACTTCTTGCAGGATCGTCATAACAAGGCCATATCTAAGGACACATGGGCACAGCTCCTGGAATTTG
CAAGGACGGTGAACCCGATGCTGTCTAATTACGATGCAGAAGGAGCATGGCCGTACCTCATTGATGAATTCGTTGAGTAT
TTGTATGACAAGAGCGTTGTTGACAAGTAA