Details for Chinese cabbage Locus Brara.A03309

Position : A01 ( 5`- 27460448 .. 27461209 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03309

Protein [Map View]
MKYLIRRLSRVADSAHYNLLRSDSQQPSRRPESFLRSSMARRSKKHTSCVPQGHVPVYVGEEMERFVVSAELLNHPVFIG
LLNRSAQEYGYEQKGVLQIPCHVLVFERVMESLRLGLTVPSDLQDLIGDETIF*

DNA
ATGAAGTATCTGATCCGCCGTCTCTCCCGCGTCGCCGACTCCGCTCACTACAACCTCCTCCGGTCCGATTCACAACAACC
GAGCCGCCGTCCCGAATCTTTCCTCCGGTCTTCGATGGCTCGCCGCTCAAAGAAGCATACATCATGTGTTCCCCAAGGAC
ACGTACCGGTCTACGTGGGAGAAGAGATGGAGAGGTTCGTTGTAAGCGCTGAGCTACTTAACCACCCGGTTTTCATCGGT
TTGTTAAACCGGTCTGCTCAAGAGTATGGTTACGAGCAAAAAGGCGTTCTACAAATCCCATGCCACGTTCTTGTCTTCGA
GCGCGTCATGGAGTCGCTTCGTCTTGGATTAACCGTGCCAAGTGACCTTCAAGATCTAATCGGCGACGAGACGATTTTTT
AG