Details for Chinese cabbage Locus Brara.A03306

Position : A01 ( 5`- 27436424 .. 27437691 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03306

Protein [Map View]
MASSLPQFYSDFTFSGETPSQFHGSSSYPDVSALSNYFDDGYGSFNPSSNPESTFFPQVFGVADVSVPDYNNYYQKVGVN
VNGAQYFHVGDQECYGYSPEIKPLFHPSTGEKSWGNSEGGIQAEPNIKVGRYSVEERKDRIMRYLKKKNQRNFNKTIKYV
CRKTLADRRVRVRGRFARNNDTSEQQSHMSKNHNNHSEKDEDMLSGSDDYLIQQMETDDGWLQEAMSNLISFPCELNAPG
DAHHPNTWSF*

DNA
ATGGCATCATCTCTTCCTCAGTTCTACTCCGATTTCACATTTTCAGGTGAGACTCCGTCGCAGTTTCACGGCTCGTCTTC
ATATCCTGACGTCTCAGCTCTATCGAATTACTTTGACGACGGCTACGGCTCCTTCAACCCATCTTCTAACCCAGAATCCA
CGTTTTTCCCGCAAGTTTTTGGGGTTGCTGACGTTTCTGTGCCGGATTACAACAATTACTACCAGAAAGTGGGTGTGAAT
GTGAATGGCGCACAATACTTTCATGTTGGGGATCAAGAGTGCTACGGCTATTCACCGGAGATCAAGCCCTTGTTCCATCC
GTCCACTGGAGAGAAATCCTGGGGAAATAGTGAAGGAGGGATACAAGCTGAGCCGAACATAAAAGTGGGACGCTATTCGG
TTGAAGAACGTAAAGACAGAATCATGAGGTACTTGAAGAAAAAGAACCAACGCAACTTCAATAAGACTATCAAGTATGTG
TGTCGTAAAACCCTAGCTGATCGGCGTGTTCGTGTTCGAGGACGGTTTGCTAGAAACAATGACACAAGTGAGCAACAATC
TCACATGTCTAAGAATCACAACAACCATTCTGAAAAAGACGAAGATATGCTTTCTGGATCAGACGACTATCTAATCCAGC
AGATGGAAACCGACGATGGATGGCTTCAAGAGGCAATGTCTAATCTGATTTCATTTCCTTGTGAATTGAATGCTCCTGGA
GATGCTCATCATCCAAACACATGGAGCTTCTGA