Details for Chinese cabbage Locus Brara.A03305

Position : A01 ( 5`- 27419252 .. 27421080 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03305

Protein [Map View]
MAANYEDRDTLFNFVVKEGNAVKGLIDSGMSCVPQPFVQPLSERIATPNGQTCEAVQPIDLSQIEGPCHTEVAKQIVEAA
ETLGFFQVVNHGVSVELLELLKMSAHEFFEQPPENENKAVYLKEVSPSKLVKYGTSFVPEKEKAIEWKDYVSMLYTNDDE
ALQHWPLQCREVALDFLQSSMAMVKRIVEVLMEDVGVILEEERMNSLVGTKMVNMNYYPTCPSPELTIGVGRHSDMGMLT
VLLQDSIGGLYVKPDNGDWAEIPPLNGALVINVGDTLILSNGKYKSAEHRVRTTNIGSRVSVPIFTAPTPSEKIGPLPEV
VERDGVARYKEVLFQDYMNNFFSQPHDGKKSLDFARAD*

DNA
ATGGCTGCCAATTACGAGGACCGAGACACATTGTTCAACTTCGTCGTCAAAGAAGGTAATGCCGTGAAGGGTCTGATAGA
CTCTGGTATGTCTTGTGTTCCACAGCCTTTTGTCCAACCGCTCTCTGAGCGAATAGCGACCCCAAACGGCCAAACGTGTG
AAGCTGTCCAGCCAATAGATCTTTCCCAGATAGAGGGTCCATGCCACACGGAGGTGGCCAAACAAATCGTTGAAGCTGCT
GAGACGCTTGGCTTCTTCCAGGTGGTGAACCATGGTGTTTCGGTAGAGCTGCTTGAATTGCTGAAAATGTCAGCTCATGA
GTTTTTCGAACAACCTCCTGAGAATGAGAACAAAGCGGTTTACCTAAAAGAAGTGAGTCCAAGCAAGCTAGTTAAGTACG
GGACGAGCTTCGTACCAGAGAAGGAGAAGGCCATTGAGTGGAAAGATTATGTGAGCATGCTTTACACCAATGACGACGAG
GCTCTTCAACACTGGCCTCTACAATGCAGAGAGGTGGCACTTGATTTCCTACAATCATCAATGGCAATGGTGAAAAGAAT
AGTTGAAGTTTTGATGGAGGATGTAGGAGTGATACTAGAAGAAGAGAGAATGAACAGTTTGGTGGGGACCAAAATGGTCA
ACATGAACTACTACCCAACATGTCCCAGCCCCGAGCTCACTATAGGCGTCGGTCGTCACTCCGACATGGGAATGTTAACT
GTTTTATTACAAGATAGCATTGGTGGTCTCTACGTTAAACCAGACAACGGTGACTGGGCTGAGATCCCTCCTCTCAATGG
AGCCTTAGTCATCAATGTTGGCGATACTTTAATTCTAAGCAATGGGAAGTATAAAAGTGCGGAGCATAGGGTTCGAACCA
CAAACATCGGATCGAGAGTCTCTGTGCCTATTTTCACGGCACCTACTCCCTCGGAGAAGATTGGTCCATTGCCCGAAGTG
GTGGAACGTGACGGGGTGGCTCGTTACAAAGAGGTGTTATTTCAAGACTACATGAACAACTTCTTCAGCCAACCACACGA
TGGCAAGAAATCTCTCGACTTTGCTCGTGCCGATTGA