Details for Chinese cabbage Locus Brara.A03304

Position : A01 ( 5`- 27413257 .. 27415130 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03304

Protein [Map View]
MDEAMGSWDTRREEQEEEEKQVLKLPGFRFHPTDEELVGFYLSKKVFLKKSSKIDEIISQIDIYKFDPWDLPRSRNTEKE
SYFFCRRGRKYRNSIRPNRVTGSGFWKATGIDKPVYSDGSSKAVIGLKKTLVYYLGSAGKGSKTDWMMHEFRLPTANDTI
PGGSTLLNPTPSSLLHAEVWTLCRIFKRNVSSRKYTPDWRELAGGKRMKPQQSKYQEAYISFGDNESSSSTNNINVMERK
ENYERNVFQLRQTPDQHQPIPVDTTITTQVDSTVPHFSNDNIHDITYENWDELRSVVEFAFGPSFHS*

DNA
ATGGATGAGGCGATGGGATCATGGGACACAAGAAGGGAAGAACAAGAAGAAGAAGAGAAACAAGTGTTAAAACTTCCAGG
GTTTAGGTTTCATCCGACCGATGAAGAGCTTGTAGGTTTTTATCTCTCTAAGAAAGTATTCCTCAAGAAATCCAGCAAGA
TAGATGAGATAATCAGCCAAATTGATATCTATAAATTCGATCCATGGGATCTTCCTCGCTCAAGGAATACGGAGAAGGAG
AGCTACTTCTTCTGCAGGAGAGGAAGGAAGTACAGAAACAGCATAAGACCGAACCGAGTGACTGGTTCCGGTTTTTGGAA
AGCCACAGGAATCGATAAGCCTGTCTATTCCGATGGCTCCAGCAAAGCCGTGATTGGTCTAAAGAAGACACTCGTTTATT
ATCTTGGAAGCGCCGGGAAAGGAAGCAAGACAGATTGGATGATGCACGAGTTTCGCCTCCCAACAGCCAATGACACCATC
CCTGGTGGCTCCACTCTCCTTAACCCTACTCCTTCTTCCTTGCTACACGCTGAAGTGTGGACGTTGTGCCGGATATTCAA
GAGAAATGTGTCTAGTAGAAAATACACTCCGGACTGGAGAGAGTTAGCAGGTGGGAAACGCATGAAGCCGCAACAATCTA
AGTATCAAGAAGCTTATATCAGTTTTGGTGACAATGAGAGTAGTAGTAGTACCAATAATATCAACGTTATGGAACGCAAA
GAGAACTATGAGAGGAACGTTTTCCAGCTTCGCCAAACGCCCGATCAACACCAGCCCATTCCAGTGGACACAACTATTAC
TACACAAGTCGATAGTACGGTTCCACATTTCTCAAACGACAACATTCACGATATAACCTACGAGAACTGGGACGAGTTAC
GATCGGTTGTGGAATTTGCCTTCGGCCCTTCTTTTCATAGTTAG