Details for Chinese cabbage Locus Brara.A03303

Position : A01 ( 5`- 27401941 .. 27403416 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03303

Protein [Map View]
MAVEAHHLNPLFSSNREMMYPVEANGLVYTNQIRYNTLPAATMPFNPTMECQTSTFNPVYNTSPVDFLVHQSMKPTIHSV
DSSVTYNSDNNNGNNVNYLPPVSSLRKRPREESVVENPMPSQKRCTDPLMFLGQDLSSNVQHHNLDIDRLISNHVEIMRM
GIEEKRKEQGRKIMEAIEQGLMKTLRAKDEEINHIGKLNLFLEEKVKSLTVENQLWRDMAQSNEATVNSLRSNLQQVLAA
VERNRWEEPTTADDAQSCCGSSDEGDSTMMRTVSSTMCRSCGKGEASVLLLPCRHMCLCSVCGSSINTCPICKSPKNASL
HVNLS*

DNA
ATGGCCGTTGAAGCACACCATCTTAATCCTTTATTTTCTTCCAACAGAGAAATGATGTATCCCGTTGAAGCGAACGGTTT
AGTCTACACAAACCAGATCAGATACAACACTCTTCCAGCGGCGACGATGCCGTTTAACCCTACCATGGAATGTCAAACTT
CTACGTTTAATCCCGTTTACAACACATCACCGGTTGATTTTTTGGTTCACCAGTCCATGAAACCAACGATCCACTCCGTT
GATAGTTCTGTCACATACAACAGCGACAATAATAATGGCAACAACGTTAATTATCTTCCTCCGGTGTCGTCTTTGAGAAA
ACGCCCCAGAGAAGAATCGGTTGTTGAAAACCCTATGCCAAGCCAGAAACGTTGCACCGATCCTCTCATGTTCCTAGGAC
AAGACTTGTCTTCTAACGTCCAACATCACAACTTAGATATCGACCGCTTGATCTCTAATCATGTCGAGATAATGAGAATG
GGGATTGAAGAGAAGAGAAAAGAACAAGGTAGGAAGATAATGGAAGCTATTGAGCAAGGGTTGATGAAGACACTTAGAGC
CAAAGATGAAGAGATCAATCACATAGGCAAACTAAACCTCTTTCTCGAAGAGAAGGTTAAGTCTCTCACTGTAGAGAATC
AGTTATGGCGTGACATGGCACAATCTAATGAAGCCACCGTAAACTCCCTACGGTCCAATCTCCAACAAGTCCTCGCCGCA
GTGGAACGTAACCGCTGGGAGGAGCCTACAACTGCTGATGACGCGCAGTCTTGTTGCGGAAGCAGCGACGAGGGTGATAG
TACGATGATGCGCACGGTTTCAAGTACGATGTGTAGAAGCTGTGGGAAAGGAGAAGCAAGTGTGTTACTGTTACCATGCA
GACACATGTGTCTATGCAGTGTGTGTGGTTCTTCGATTAACACTTGTCCAATCTGTAAATCTCCAAAGAACGCTAGTCTT
CATGTTAATCTTTCCTAA