Details for Chinese cabbage Locus Brara.A03301

Position : A01 ( 5`- 27388492 .. 27391696 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03301

Protein [Map View]
MRQPGSAGQHCEFTAASYFSWPTSSRLSNAAEERANYFSNLQKEEDEEEEVSPEPASTEPKGQRATTLLELMTIRAFHSK
ILRCYSLGTAIGFRIRRGVLTDIPAIIVFVSRKVHKQWLSPLQCLPTALEGAGGIWCDVDVVEFSYFGEPDHQPTPKQTF
TTDIVDHLQGSDPFIGSGSQVASQETCGTLGAIVRSQTGGRQVGFVTNRHVAVNLDYPSQKMFHPLPPALGPGVYLGAVE
RATSFITDDLWFGIFAGTNPETFVRADGAFIPFADDYDLSRVTTSVKGGVGEIGEVKAIELQSPVGSLVGKQVVKVGRSS
GLTTGTVLAYALEYNDERGVCFLTDFLVVGENHRSPFDLEGDSGSLIVMKGEEENARPIGIIWGGTGSRGRLKLKVGESP
ESWTTGVDLGRLLTHLQLDLITTDEGLKAAVQEQRAASTTGMSSMVADSSPPYVNLKKEKRSPEEKVEASLGPLQVQHID
LEERIETKGGPPSVEHQFMPSFSGQCSVSAWPETAREDLNAGLANGGCDGDLCVGLRLGEGDNGTKRRRTEMTKDRMRPA
E*

DNA
ATGCGTCAGCCAGGATCAGCAGGTCAACACTGTGAGTTCACGGCGGCGTCTTACTTCTCATGGCCGACTTCAAGCAGGCT
AAGCAACGCAGCGGAGGAGAGAGCCAACTACTTCTCAAACTTGCAGAAGGAAGAGGATGAGGAGGAAGAGGTTTCTCCTG
AACCAGCTTCCACCGAGCCCAAAGGGCAACGAGCCACAACTTTGCTCGAGCTCATGACCATAAGAGCCTTCCACAGCAAG
ATCCTGCGCTGTTACAGTCTTGGAACCGCCATAGGGTTCCGGATCCGAAGAGGAGTTCTCACGGATATACCTGCTATCAT
TGTGTTTGTGTCTAGGAAAGTTCATAAGCAGTGGCTTAGCCCTCTTCAGTGTCTTCCTACTGCTCTTGAGGGAGCAGGAG
GGATATGGTGTGACGTAGATGTAGTGGAGTTTTCGTATTTTGGAGAACCTGATCATCAGCCTACTCCTAAACAAACATTC
ACCACTGATATTGTTGATCATCTCCAAGGATCTGATCCCTTCATTGGATCTGGCTCTCAGGTGGCAAGCCAGGAGACTTG
TGGGACTTTAGGTGCAATAGTGAGAAGTCAAACAGGAGGTAGACAAGTTGGGTTTGTGACTAACCGTCACGTTGCTGTTA
ACTTAGACTATCCAAGCCAGAAGATGTTTCATCCTCTCCCTCCTGCTCTTGGCCCTGGTGTCTACCTTGGAGCCGTTGAG
AGAGCCACTTCCTTCATCACAGACGATCTTTGGTTTGGCATTTTCGCTGGCACCAATCCAGAGACGTTTGTGAGAGCAGA
TGGAGCATTCATCCCCTTTGCAGACGACTACGACCTGTCACGTGTCACAACGTCTGTCAAAGGTGGAGTAGGAGAGATTG
GAGAGGTCAAAGCCATTGAGCTGCAGTCACCAGTTGGGAGTTTAGTAGGGAAACAGGTGGTGAAAGTCGGTAGAAGCTCC
GGCTTGACTACAGGAACCGTTCTGGCTTATGCTTTGGAGTACAATGACGAGAGAGGTGTCTGCTTCCTCACTGACTTCCT
TGTTGTTGGGGAGAACCATCGCAGTCCTTTTGATCTTGAAGGAGATAGCGGGAGCTTGATAGTGATGAAAGGAGAGGAGG
AGAATGCGAGGCCTATTGGGATCATATGGGGAGGCACTGGTAGCCGTGGGAGGTTGAAGCTGAAAGTAGGTGAGTCTCCA
GAGAGCTGGACTACTGGAGTTGATCTGGGAAGGTTACTTACACATCTTCAGCTTGATCTAATCACCACCGATGAAGGGTT
GAAAGCGGCAGTGCAAGAGCAACGAGCTGCTTCAACAACGGGGATGAGCTCAATGGTTGCAGACTCATCACCTCCGTATG
TGAATCTCAAGAAAGAGAAGAGAAGCCCTGAGGAGAAGGTAGAGGCGTCGTTAGGACCTCTTCAGGTCCAACACATCGAT
CTTGAAGAGAGGATAGAAACAAAAGGAGGTCCTCCGAGTGTGGAGCACCAGTTCATGCCGAGCTTCAGCGGTCAGTGTTC
AGTGTCTGCTTGGCCTGAGACAGCTAGAGAGGATCTTAATGCTGGTCTTGCAAATGGTGGATGCGATGGGGATTTATGTG
TGGGACTGCGTTTAGGAGAAGGGGACAATGGAACTAAACGCAGACGCACTGAGATGACTAAGGATAGAATGAGACCCGCT
GAATAG