Details for Chinese cabbage Locus Brara.A03300

Position : A01 ( 5`- 27386609 .. 27387031 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03300

Protein [Map View]
MKKMRMMMLLRRCKSVSTQLSRSYSYTSLRSQSARRDPQDHLHDIDQSSPTPSLYQTVLVGRTKKPYLISKQHLKHPLLN
ALVEKQQRYEDDDGDEDGSCIITVKCEVVLFDHLLWMLENGDQGQILESLDDFAHLYLSP*

DNA
ATGAAGAAGATGAGAATGATGATGCTGTTAAGGAGATGCAAGAGCGTGTCCACACAATTAAGTCGTTCATATTCCTACAC
AAGCCTCAGATCCCAATCAGCAAGAAGAGATCCACAAGACCATCTCCATGACATCGACCAAAGCAGCCCTACACCGTCTT
TGTACCAGACAGTGTTGGTCGGACGTACCAAGAAACCTTACTTGATCAGTAAGCAACACCTGAAGCACCCTTTACTCAAC
GCTCTTGTGGAGAAGCAACAGAGGTACGAAGATGATGATGGTGATGAAGATGGAAGCTGTATAATTACTGTGAAATGTGA
AGTTGTTTTGTTCGATCATCTCCTTTGGATGCTTGAAAACGGAGACCAGGGGCAAATACTCGAGTCTTTAGATGACTTTG
CCCATCTCTATCTCTCTCCTTGA