Details for Chinese cabbage Locus Brara.A03299

Position : A01 ( 5`- 27385962 .. 27386228 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03299

Protein [Map View]
MAKNKDDIKYATAQTKQSEDEAIRVRYKHGTPLEGGKIAESEPVELFSSAQGIEKGKDQAASEITGEQKQMHRDVKDVPG
TRTDDSPR*

DNA
ATGGCAAAGAACAAAGATGACATAAAGTATGCAACCGCTCAAACGAAGCAATCGGAAGACGAGGCGATTCGAGTGAGATA
CAAACACGGGACACCACTGGAAGGAGGAAAGATCGCAGAGTCTGAGCCTGTAGAGTTGTTCTCAAGCGCTCAAGGAATCG
AAAAGGGAAAGGATCAGGCAGCGTCTGAGATCACTGGAGAACAGAAACAGATGCACCGTGACGTGAAAGATGTCCCCGGA
ACGCGTACAGATGATAGCCCTCGTTAA