Details for Chinese cabbage Locus Brara.A03294

Position : A01 ( 5`- 27350220 .. 27353147 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03294

Protein [Map View]
MNSHRLVVSTAQEECNKGIQKACSSSLSPAFNFLNVQPETTRKSPFIRSQSPDWPKNSTFSRSSTFCTNLYSSSSSANET
QKHLGNSLPFLPDPSASASGVESARSPSVFSEDLGNPFDGDNNSSLVKDFFNLSADACSNGGGYHDLDCSNDTLSDQLEL
QFLSDELELAITDRAETPRLDEIYEKPMASPNPVTVLSPSQRCDAGAMCIDPVSSLPSPRSSAAANHKPRMRWTPELHES
FLKSVNKLEGPEKATPKAVLKLMNVEGLTIYHVKSHLQKYRLAKYMPEKKEEKKNVNSEEKKLALSNSEADEKKKGAIQL
TEALRMQMEVQKQLHEQLEVQRVLQLRIEEHAKYLEKMLEEQRKAGRLFSSSSSSQTLLSPSDDETRPDSQNLSKTEASL
LQPSSSAKNIASETEDDQCESPQKRRRLENSTEPQDSER*

DNA
ATGAACAGTCATAGGCTTGTTGTGTCAACGGCACAAGAGGAATGCAACAAAGGAATTCAAAAAGCTTGCTCGTCTTCTCT
CTCTCCAGCCTTTAACTTTCTGAATGTCCAGCCAGAAACCACCAGAAAATCTCCTTTCATACGGTCACAATCTCCAGATT
GGCCAAAGAATAGTACGTTTTCACGGTCGTCAACCTTCTGCACAAACCTCTACTCCTCATCTTCTTCAGCCAATGAGACT
CAGAAACATTTGGGAAACAGTCTTCCTTTCCTCCCTGATCCCTCTGCTTCTGCTTCTGGTGTGGAGTCCGCAAGATCTCC
ATCTGTTTTCAGCGAGGATTTGGGCAATCCGTTTGATGGAGACAACAACTCCTCGCTTGTCAAAGATTTCTTTAATCTCT
CCGCGGATGCTTGTTCCAATGGAGGTGGTTATCATGATCTTGACTGTTCCAACGACACCTTATCAGATCAGCTGGAGCTG
CAGTTCCTGTCTGATGAACTTGAGCTGGCCATCACAGACCGAGCTGAAACTCCAAGGCTTGATGAGATCTATGAAAAGCC
AATGGCTTCGCCAAATCCAGTGACTGTGCTGAGTCCAAGCCAAAGATGCGATGCTGGAGCAATGTGCATTGACCCAGTTT
CATCTCTCCCTTCTCCAAGATCCTCAGCAGCAGCCAATCACAAGCCGAGAATGAGATGGACCCCTGAGCTCCACGAAAGT
TTTTTGAAGTCAGTGAACAAACTTGAAGGGCCTGAAAAGGCCACTCCAAAGGCTGTTCTGAAGCTTATGAATGTTGAGGG
CTTGACGATCTACCATGTAAAAAGCCACTTGCAGAAGTATAGACTAGCAAAGTATATGCCAGAGAAAAAAGAAGAGAAAA
AGAATGTTAACTCAGAGGAGAAGAAACTCGCTTTGAGCAACAGTGAAGCTGATGAGAAGAAGAAAGGGGCAATACAACTA
ACTGAAGCTCTCCGTATGCAGATGGAAGTTCAAAAGCAATTGCATGAACAACTCGAGGTGCAGCGGGTGCTTCAGCTACG
AATAGAAGAGCATGCTAAATACTTGGAGAAGATGCTTGAAGAACAACGCAAAGCCGGAAGGCTATTTTCTTCTTCTTCTT
CTTCTCAGACTTTGTTATCACCTAGTGATGATGAGACTAGACCAGACTCTCAAAACCTGTCCAAGACCGAAGCATCTCTG
CTTCAGCCTTCATCATCTGCAAAGAACATAGCTTCTGAAACCGAAGACGATCAATGCGAGTCCCCTCAGAAACGTCGCAG
GCTTGAGAACAGTACTGAACCTCAAGACTCTGAGAGGTAG