Details for Chinese cabbage Locus Brara.A03293

Position : A01 ( 5`- 27345311 .. 27347900 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03293

Protein [Map View]
MEEGNPSFTVDEALVGIGFGKFQLFVLAYAGMAWVAEAMEMMLLSFVGPAVQSLWNLSAREESLITSVVFAGMLIGAYSW
GIVADKHGRRKGFIITAVVTFLAGFLSSFAPNYMSLIVLRCLVGLGLGGGPVLVSWYLEFIPAPNRGTWMIVFSAFWTVG
TIFEASLAWLIMPSLGWRWLLALSSVPSSLLLVFYRWTPESPRYLILQGRKAEAQSILQKIARMNGTHLPKGVLRSEIEE
KNKSLPTENTHLLKPEEESKIVVADNNGPGFILLTLLSPELIKRTLLLWVVFFGNAFAYYGVVLLTTELNNSQNSCHPTG
EVLQHSSNDVNYKDVFIASFAEFPGLLISAAMVDRLGRKVTMSSTLFLCCIFLLPLLTHQPPAITTALLFGGRVCVSAAF
AVVYIYAPEIYPTAVRTTGVGVASSVGRIGGVLCPLVAVGLVHGCHQTVAVLLFEVVMFVSGICVCLFPFETSGRELTDT
ISTSKKPPSSSSSV*

DNA
ATGGAAGAAGGGAACCCTAGTTTCACAGTGGATGAAGCACTTGTGGGGATTGGATTTGGAAAGTTTCAACTCTTCGTTCT
TGCTTACGCTGGAATGGCTTGGGTTGCTGAGGCTATGGAGATGATGCTCCTCTCTTTCGTTGGACCTGCTGTTCAGTCGC
TGTGGAACCTCTCTGCACGTGAGGAGAGCTTGATAACTAGCGTCGTTTTTGCTGGTATGCTCATTGGAGCTTACTCTTGG
GGTATTGTTGCTGACAAACATGGCCGCAGGAAAGGGTTTATAATAACTGCTGTGGTGACTTTCCTAGCTGGTTTCTTGAG
CTCATTTGCACCAAACTACATGTCCCTGATCGTTCTCCGCTGTCTTGTTGGTCTGGGACTGGGAGGAGGTCCTGTTCTCG
TCTCCTGGTATCTCGAATTCATCCCTGCGCCAAACCGAGGGACTTGGATGATTGTTTTCTCAGCTTTCTGGACCGTTGGA
ACCATCTTCGAGGCTTCACTCGCTTGGCTAATCATGCCAAGCTTAGGTTGGAGGTGGCTGCTCGCACTCTCTTCCGTACC
TTCCTCGCTGCTTCTTGTCTTCTATAGGTGGACGCCTGAGTCTCCTCGGTACTTAATCCTCCAAGGCCGGAAAGCTGAAG
CTCAATCCATACTCCAGAAGATTGCGAGAATGAACGGAACCCACTTACCTAAAGGTGTTCTCCGCTCAGAGATTGAAGAG
AAGAATAAAAGCCTTCCAACAGAAAACACTCATCTCCTCAAGCCTGAAGAAGAATCTAAGATAGTAGTAGCTGACAACAA
CGGACCAGGCTTCATTTTGCTAACTCTTCTATCTCCGGAGCTAATCAAACGGACTCTCCTACTATGGGTTGTATTCTTTG
GAAACGCCTTTGCTTACTACGGCGTTGTCCTTCTCACCACCGAGCTCAACAATTCCCAAAACAGTTGCCATCCAACAGGA
GAAGTGTTGCAACATTCTTCAAACGATGTTAACTACAAAGACGTTTTCATCGCCAGTTTTGCAGAGTTTCCAGGGCTACT
AATATCAGCAGCAATGGTGGACAGGCTTGGACGCAAAGTGACCATGTCATCAACGCTATTCCTCTGCTGCATCTTCCTTC
TTCCTCTGTTAACTCACCAACCACCAGCCATAACCACAGCTCTTCTCTTCGGCGGCCGTGTCTGCGTCTCCGCAGCCTTC
GCGGTGGTTTACATCTACGCACCGGAGATATATCCCACGGCGGTAAGAACGACCGGAGTAGGAGTGGCTAGCTCTGTGGG
GAGAATCGGAGGAGTGCTATGTCCACTGGTAGCCGTGGGGTTGGTTCACGGATGCCATCAGACAGTGGCTGTTCTTCTCT
TCGAGGTAGTGATGTTTGTCTCAGGAATCTGCGTTTGTCTCTTCCCGTTCGAGACCAGTGGTCGTGAGCTGACGGATACT
ATCTCTACATCCAAGAAGCCACCTTCATCTTCATCCTCTGTATAG