Details for Chinese cabbage Locus Brara.A03291

Position : A01 ( 5`- 27338933 .. 27341209 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03291

Protein [Map View]
MFVYKPIRSPSCFLLEIWDLMNSGNTLSKLALYFSSSEVFFRRADGGDGVFCYCWATVLALVFIFLCHIFRKVRVFTHAS
SSSPTVSVSQSLRSSQSGISTLVSDEDLKGLIKKLGERDGDAEIWEDIIHKSNPTRVSYTAKCCKPKDGGPMKYLSTTVF
EDCSPEALRDFYMDNEYRKQWDKTVVEHEQLQVDSSSGVEIGRTIKKFPFLTPREYVLAWRLWEGMNDKFYCFIKDCDHN
MVPQQRKYVRVSYFRSGWRIRKVPGRNACEIHMFHQEDAGLNVEMAKLAFSRGIWSYVCKMESALRKYTATSHRPQGPTV
SAVSLMKKIPSELENETDDITNSLGTMHRGEGAKRKKLLRKPSKKQIANGLLLVGGAVGGAVCLSRGHSASLGAKVALAY
FLTKLSKRGAPLSQTSQNAGI*

DNA
ATGTTTGTTTATAAACCCATTCGATCTCCAAGTTGTTTCCTTCTAGAGATTTGGGATTTAATGAATAGTGGCAACACCTT
ATCGAAGCTAGCTCTTTATTTCTCCTCTTCCGAGGTTTTTTTCCGGCGAGCTGACGGTGGTGATGGAGTCTTTTGTTACT
GCTGGGCCACCGTATTAGCACTTGTCTTCATTTTCCTCTGCCATATCTTCCGCAAAGTTCGAGTCTTTACTCATGCTTCT
TCGTCTTCACCTACCGTATCAGTTTCTCAGTCTCTGAGGAGCTCCCAATCAGGAATATCTACACTTGTTTCTGATGAAGA
TCTGAAAGGACTGATTAAAAAACTGGGGGAGAGAGATGGAGATGCTGAGATTTGGGAAGATATCATTCACAAAAGCAACC
CTACTCGCGTCTCGTACACTGCCAAATGCTGCAAACCAAAAGACGGTGGTCCCATGAAGTACTTAAGTACCACGGTGTTT
GAGGACTGCTCTCCAGAGGCTTTGAGGGACTTTTACATGGACAATGAGTACAGGAAACAGTGGGATAAGACCGTGGTCGA
GCACGAGCAGTTGCAGGTCGACAGTAGCAGCGGAGTTGAGATTGGTCGGACGATAAAGAAGTTTCCTTTCTTGACACCAA
GGGAGTATGTATTAGCTTGGAGGTTGTGGGAGGGGATGAATGATAAGTTCTATTGTTTCATCAAGGATTGTGATCACAAT
ATGGTGCCGCAACAGAGGAAGTATGTACGTGTGAGTTATTTCAGATCTGGTTGGCGAATTAGGAAAGTTCCAGGTAGGAA
TGCATGTGAGATCCACATGTTCCACCAGGAAGATGCTGGATTAAATGTTGAGATGGCAAAGCTTGCTTTCTCAAGAGGCA
TATGGAGTTACGTTTGTAAGATGGAAAGTGCACTTCGTAAGTACACTGCAACCAGTCATAGGCCCCAAGGGCCCACTGTA
TCTGCTGTCAGCTTAATGAAAAAGATTCCATCAGAGTTAGAGAATGAGACAGATGACATCACAAACTCCTTGGGAACGAT
GCACAGAGGTGAAGGAGCCAAACGGAAGAAGCTGTTGAGAAAGCCTTCAAAGAAACAGATAGCAAACGGTCTGTTACTTG
TGGGCGGTGCAGTTGGTGGTGCGGTTTGCCTCTCTCGTGGTCACTCCGCCTCCTTAGGTGCAAAGGTTGCCCTGGCTTAC
TTCTTGACGAAGCTGAGCAAGCGTGGAGCTCCACTTAGTCAGACTTCACAGAACGCTGGTATTTAA