Details for Chinese cabbage Locus Brara.A03287

Position : A01 ( 5`- 27319304 .. 27320264 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03287

Protein [Map View]
FEAKRRGALRGRRRRKIGSWFENPMAVSSVTSFTLPSSSNPSSSSSPTRQKLSLLSLLPSSSSTHGSISSSVLNKPSSSF
TNKVFAAPETLDEPSSQEFSEVPSSSSISVDADKMAPKQKIRIKLRSYWVPLIEDSCKQILDSARNTNAKTMGPVPLPTK
KRIYCVLKSPHVHKDARFHFEIRTHQRMIDILYPT

DNA
TTTGAAGCGAAGAGAAGAGGAGCATTGAGAGGAAGAAGAAGAAGAAAGATCGGTTCTTGGTTTGAGAATCCAATGGCGGT
TTCTTCTGTAACATCATTCACGTTACCCTCTTCCTCCAACCCTTCCTCTTCGTCTTCTCCTACCAGACAGAAACTCTCTC
TGCTTTCACTGCTTCCATCTTCTAGTTCTACTCATGGCAGCATTAGCTCCTCCGTCCTTAACAAACCCTCCTCCTCGTTC
ACGAATAAGGTCTTCGCTGCTCCAGAAACTCTCGATGAACCATCCTCTCAGGAATTCTCCGAGGTTCCGAGCTCTTCCTC
CATAAGTGTAGACGCAGATAAGATGGCGCCAAAGCAAAAGATTAGGATCAAGCTTAGATCATACTGGGTGCCTCTCATTG
AGGACTCATGCAAGCAGATCCTTGACTCTGCGAGGAACACCAATGCTAAGACTATGGGTCCTGTTCCATTGCCGACCAAG
AAGCGTATCTACTGTGTTCTCAAGTCTCCCCACGTTCACAAGGATGCAAGGTTTCACTTTGAGATCCGGACTCACCAGCG
GATGATTGATATTCTCTACCCTACT