Details for Chinese cabbage Locus Brara.A03286

Position : A01 ( 5`- 27315601 .. 27316215 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03286

Protein [Map View]
MQVNNNCDLCDQKVTEIMHSIIAVYSVTYGNIMKLEARANPNLFMAVVYKYRDHGKIIRLHFEGAPIAPQPGEGRGGGAY
YNAPQVNYPYHSPYAPPQQQLLAGNFGYPMLKPPPPQQKEAPEGVYKQHTVPPPFAMQPPPPMPLSSYSYIEPPYWPVAT
ASGGKCVIM*

DNA
ATGCAAGTGAATAATAACTGTGACCTTTGCGACCAAAAAGTAACGGAAATTATGCATTCTATCATTGCTGTTTACTCTGT
GACTTATGGCAATATAATGAAGCTGGAGGCTAGAGCTAACCCTAATTTGTTTATGGCGGTTGTTTATAAGTATCGCGATC
ACGGCAAGATCATAAGGCTCCACTTTGAAGGCGCACCTATCGCTCCTCAACCTGGAGAAGGAAGAGGAGGAGGAGCCTAT
TACAACGCCCCTCAAGTTAATTATCCATACCATTCTCCTTATGCTCCTCCACAGCAGCAGCTTCTCGCTGGAAACTTTGG
TTATCCGATGTTGAAACCGCCTCCGCCACAGCAGAAGGAGGCTCCAGAGGGGGTGTATAAGCAGCATACTGTGCCTCCTC
CTTTTGCTATGCAGCCGCCACCGCCAATGCCGTTGTCTAGTTACTCTTACATTGAACCTCCCTATTGGCCGGTGGCTACG
GCGAGTGGTGGTAAGTGTGTGATTATGTGA