Details for Chinese cabbage Locus Brara.A03284

Position : A01 ( 5`- 27308090 .. 27310570 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03284

Protein [Map View]
MEGNFQISETTNLLRKIKEFTRSIVEDLAEGKSPEISINRFRNYCNDPEADCFCSSDEPKGREILTLRKRSQTYRIDMLL
RVLLIVQQLLQENRHGSKRDIYYMHPSAFKAQSVVDRAIADICILFQCSRYNLNVVSVGNGLVMGWLKFREAGRKFDCLS
SLNTAFPVPVLVEEVEDIVSLAEYILVVEKETVFQRLANDMFCKTNRCIVVTGRGYPDVSTRRFLRLLMEKLQLPVHCLV
DCDPYGFEILATYRFGSMQMAYDIESLRAPEMKWLGAFPSDSDIYGVPQQCLLPLTEEDKKRTEAMLLRCYLKREMPQWR
LELETMLKRGVKFEIEALSVHSLSFLSEVYIPSKIRSEGSFH*

DNA
ATGGAGGGAAATTTTCAAATTTCAGAGACGACTAATCTGCTTCGAAAGATCAAAGAGTTTACGCGATCGATCGTTGAAGA
TCTAGCCGAGGGAAAATCTCCAGAAATCTCCATCAATCGATTCAGAAACTACTGCAACGATCCAGAAGCAGACTGTTTTT
GCAGCTCCGATGAACCGAAAGGTCGGGAGATTCTCACGCTTAGGAAGAGATCGCAAACCTATAGAATCGATATGTTGCTG
AGAGTATTGTTGATAGTTCAACAACTACTTCAAGAAAATAGACATGGATCCAAAAGGGATATCTACTATATGCACCCATC
AGCATTCAAAGCACAATCAGTTGTAGACCGCGCAATTGCTGATATATGCATCCTTTTTCAGTGTAGTCGGTACAACTTGA
ATGTGGTTTCTGTTGGAAATGGGTTGGTGATGGGGTGGTTAAAGTTTAGGGAAGCTGGAAGGAAGTTTGATTGTTTAAGC
AGCCTGAATACTGCATTTCCCGTTCCTGTTCTTGTAGAGGAAGTCGAAGATATTGTTAGTTTGGCAGAGTACATACTGGT
GGTGGAAAAAGAAACAGTATTCCAGCGTTTAGCAAATGACATGTTTTGCAAGACGAACCGCTGCATCGTTGTCACAGGAA
GAGGCTATCCTGACGTCTCTACAAGAAGGTTCTTGCGACTCCTGATGGAGAAGTTGCAACTACCTGTGCATTGTCTAGTC
GACTGTGATCCATATGGCTTTGAGATCCTAGCCACATACCGTTTTGGCTCCATGCAAATGGCCTATGATATAGAATCATT
ACGAGCACCAGAAATGAAATGGTTGGGAGCTTTTCCTTCAGACTCTGACATATACGGTGTTCCCCAACAGTGTCTCTTGC
CCTTGACAGAAGAAGATAAGAAAAGAACTGAAGCAATGTTGCTTAGATGCTACCTGAAACGTGAAATGCCACAATGGAGG
TTGGAACTTGAAACGATGCTGAAAAGAGGAGTGAAGTTTGAGATCGAAGCACTCTCAGTTCACTCGCTCTCGTTTTTATC
AGAAGTTTACATTCCTTCTAAAATACGTAGTGAGGGAAGCTTCCATTGA