Details for Chinese cabbage Locus Brara.A03282

Position : A01 ( 5`- 27305810 .. 27306597 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03282

Protein [Map View]
MNIAYPSLLHIHLSWLANKSHRSLMEFREKLLKFKFHIIFAFVFSLLTVALVTYSPGFLTVLSYFWPLFLSTALFLAAVF
FFARTSDLQTSSTISSDGSGVKLAAEGILDYVVGGQQEETDLLDSFTKLD*

DNA
ATGAATATTGCTTACCCCTCTCTCTTACATATCCATCTCTCCTGGTTAGCAAACAAAAGTCACAGATCTTTGATGGAGTT
CCGAGAGAAGCTGTTAAAGTTCAAGTTCCACATCATCTTCGCCTTCGTTTTCTCTCTCCTCACCGTCGCTCTCGTCACTT
ACTCTCCAGGTTTCCTCACCGTTTTGTCTTACTTCTGGCCTCTATTTCTCTCGACCGCTTTATTTCTTGCCGCCGTTTTC
TTCTTCGCCCGAACCTCCGACCTTCAGACGTCGTCTACCATCTCCAGCGATGGCTCTGGCGTAAAGTTAGCGGCAGAGGG
GATCCTTGACTATGTGGTCGGCGGACAACAGGAAGAAACTGATCTCCTTGATAGCTTCACTAAACTCGACTAG