Details for Chinese cabbage Locus Brara.A03278

Position : A01 ( 5`- 27293304 .. 27296535 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03278

Protein [Map View]
MTTSNGGDVGSRVSIPADLRETFQNIREYTGKQHSDEDIFSVFKDCLNDPHETAQKLLFLDTFHEVKGKRERKKESLVPK
TEDKGRNGRRNFASNYSGANNGRSGAFTRQSGSNHRTRRPMKASKPVIPPSGVSNSNITEEHPPSKCTSSSEDVSELKKS
NASETVPVSDSVVQNGTQCAVDGTSKSSQQSSTSSQRSATSNCGSQSDQVIRSESAGPKGNNQSLLKSDVGERPHVTFPA
HLQVAKMLENGLTFGSFDSNFVKETCCDNRTFGCDDSIIKSSHGTAVYGASDRKDISTFSQDDNEISNSAPETELALQSN
QTVQLVEGSEVDKLNEESLPIKDIHQADVPPISYPDQSSIAASQQAMHLLRQQYPLNFFPYGLYYSQPFYIPQPYIQQFL
TPNGFQQQSYLPPQDDAALPPGDKLHSPQIKPGNNTGNSPPASFPSPYDSYAAAFNHIPSPPTTVNSTHKEEKKEDDYTT
VPLSLANLQASAMYNLSLQGQPLPFPTLHAGFTGIYQQTPPILQAPTISPVTEQPIGPPLVTNQQPQAAPTNMDNNY*

DNA
ATGACTACCAGCAACGGCGGCGATGTGGGGTCTAGGGTTTCGATTCCGGCCGATCTGCGTGAAACCTTTCAGAACATCAG
GGAGTACACGGGGAAACAGCATTCCGACGAGGATATCTTCTCCGTCTTCAAGGATTGCCTCAACGATCCACACGAGACCG
CACAGAAGCTCCTCTTTCTAGATACGTTTCATGAGGTGAAAGGCAAACGGGAGAGAAAGAAAGAGAGTTTAGTGCCAAAG
ACAGAAGACAAGGGCAGGAATGGTCGGAGGAACTTCGCGTCAAATTACAGTGGTGCTAATAATGGAAGAAGTGGAGCTTT
TACAAGGCAGAGTGGTTCTAATCACAGAACAAGACGTCCCATGAAGGCGTCTAAGCCTGTGATTCCTCCAAGTGGAGTTA
GTAACTCGAATATTACAGAAGAACACCCTCCCTCCAAGTGTACTTCTTCTTCGGAGGATGTTTCTGAGCTGAAGAAGTCT
AATGCAAGTGAAACTGTACCTGTATCAGATTCTGTTGTACAAAACGGTACTCAGTGTGCTGTAGATGGAACTTCTAAGAG
CTCACAGCAATCATCTACTTCTTCTCAGCGATCAGCCACTTCTAATTGCGGTAGCCAGTCAGATCAAGTCATTAGGAGTG
AGTCTGCAGGCCCAAAAGGCAATAATCAATCGCTTCTCAAGTCAGATGTTGGTGAACGGCCCCATGTAACGTTCCCTGCC
CACCTTCAGGTTGCCAAAATGCTGGAAAATGGTCTGACGTTTGGGAGCTTCGATTCCAATTTTGTGAAAGAAACATGTTG
TGATAATCGTACCTTTGGATGTGATGACTCCATTATCAAGTCTTCTCATGGGACAGCAGTCTATGGGGCGTCAGATAGGA
AAGATATATCAACTTTTTCTCAAGATGATAATGAGATTTCGAATTCAGCACCTGAGACAGAGCTTGCGTTGCAGTCAAAT
CAAACTGTTCAACTTGTAGAAGGTTCCGAAGTAGATAAACTGAACGAGGAGTCTTTACCAATCAAAGACATTCACCAGGC
TGATGTTCCACCTATCTCGTATCCTGATCAGAGTTCCATAGCAGCCTCTCAACAGGCAATGCACCTTCTCAGGCAACAAT
ACCCTCTAAACTTTTTCCCTTACGGTCTCTATTATTCCCAACCCTTCTATATACCGCAACCATACATTCAACAGTTCTTG
ACCCCAAACGGGTTCCAACAACAGTCTTACTTACCACCTCAAGATGATGCTGCACTACCTCCTGGAGATAAACTCCATTC
CCCTCAGATCAAACCAGGAAACAACACTGGAAACTCTCCACCTGCCTCATTTCCATCACCATATGATTCGTACGCAGCTG
CTTTTAACCACATCCCATCACCACCCACCACCGTAAACTCTACCCACAAGGAAGAAAAGAAGGAAGACGACTACACGACT
GTGCCACTGAGTCTAGCTAACCTGCAGGCCAGTGCCATGTACAACTTATCCCTTCAGGGCCAGCCATTACCTTTCCCGAC
CTTGCACGCTGGGTTCACAGGAATATACCAACAAACACCGCCCATACTGCAGGCTCCAACTATATCTCCGGTGACCGAAC
AACCAATAGGACCCCCGCTCGTAACTAATCAGCAACCTCAAGCTGCGCCCACGAATATGGACAACAACTACTAG