Details for Chinese cabbage Locus Brara.A03275

Position : A01 ( 5`- 27275715 .. 27278267 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03275

Protein [Map View]
MGSRSRNENFQSGDGASPGKIFIGGLHKDTTNTEFNKHFGKYGEITDSVIMRDRHTGLPRGFGFITFADPSVVDQVIDDT
HTFNGKQVEIKRTIPKGAGSGGNQSKDFKTKKIFVGGIPSSVTEDELKDFFAKYGTIVEHQIIRDHETNRSRGFGFVIFD
SEEVVDELLSKGNMVDMADTKVEIKKAEPKKSSNRSPPSYGSHPRGRSSFNDSYGGPYGGPYGGFDGGYGPPPGPIRSHG
GPPSRFAAGYGYGRGGVGPEFGGGYGGYGGGSLGYRSEPPLGYSSRFGPYGSGFGGEGYGGGGGGGGGYGRGGGEGYGGY
GGGPGYGGGFESGGPGGSYEGAGGPGPYGRGYSSSSRYHPYAR*

DNA
ATGGGATCCAGATCTCGCAACGAAAACTTTCAATCCGGCGATGGCGCTAGCCCAGGGAAGATATTCATCGGAGGATTACA
CAAGGACACCACCAACACTGAGTTCAATAAGCACTTTGGCAAGTACGGAGAGATTACAGACTCGGTGATAATGAGAGATC
GACACACGGGACTACCTAGAGGTTTCGGTTTCATCACCTTTGCTGATCCTTCTGTTGTTGATCAAGTCATCGATGATACT
CATACCTTCAATGGCAAACAGGTTGAGATCAAGAGGACGATTCCTAAAGGTGCTGGTAGTGGTGGGAACCAGTCTAAGGA
TTTCAAGACTAAGAAGATTTTCGTTGGTGGTATACCCTCTTCGGTTACTGAAGATGAGCTCAAGGACTTTTTTGCAAAGT
ATGGGACCATAGTGGAGCACCAGATTATCCGAGACCATGAGACAAACAGGTCCCGAGGTTTCGGTTTTGTGATTTTCGAC
AGCGAGGAGGTTGTTGATGAGTTGTTGTCTAAAGGAAACATGGTCGACATGGCGGACACTAAGGTGGAGATCAAGAAAGC
CGAACCAAAGAAATCTTCGAACCGTTCACCTCCTTCTTATGGTAGTCACCCTAGAGGCCGTTCTTCCTTTAACGATAGTT
ATGGCGGACCTTACGGTGGACCTTACGGAGGTTTTGATGGAGGGTATGGTCCTCCTCCAGGTCCCATTAGGTCACATGGA
GGTCCTCCTAGTAGGTTTGCTGCGGGATATGGGTATGGTCGTGGCGGTGTAGGCCCTGAGTTTGGAGGAGGGTATGGTGG
CTATGGGGGTGGTAGTTTAGGTTACAGGAGTGAACCACCCCTTGGCTATTCTAGTCGTTTTGGACCCTATGGAAGCGGGT
TTGGTGGTGAGGGCTATGGAGGTGGTGGTGGTGGTGGTGGAGGGTATGGTCGTGGAGGAGGGGAAGGCTACGGGGGATAT
GGTGGTGGCCCAGGTTATGGTGGGGGGTTTGAATCAGGTGGCCCAGGTGGCAGTTATGAAGGAGCAGGTGGTCCTGGCCC
ATATGGCAGAGGTTATAGTAGCAGTAGTCGATACCATCCATATGCAAGATAG