Details for Chinese cabbage Locus Brara.A03274

Position : A01 ( 5`- 27270898 .. 27275246 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03274

Protein [Map View]
MGKRKERRFAANNTSRRVKLDLFAEPSGDLGGSDVRSDGDEKEQTEPNELPKSPSSSGQKTENPLLLLGQYSDEEEEVED
EKEDKADDATAESSLANKNEKVEARKDTNVKSGADTTMQMVDQQQTGEDSSASYYMAEGGSGYVTASNSTAADGLTKQID
PSVQASATVSLEQYAPTDVTSQWKMILHEESNQYYYWNTLTGETSWEIPPVLSQTATAYGTGYHESGAMVTDAYNLSSGV
EPSYLQQPVENVYTGTDCSTSLTAQPGEGNKSEDHYAKSFGTDGHQVECQIDSAVNYQPSQEELAGPRNSDHVQATAVQV
SATDLPSRLLSQSEGLLEKLRSLKKSHGNFNSNEQISKYILELEVRHSDVKALLNDTSPLLSFWLHTEKELKRLEDGVND
EIYELAKSAVMDGIAETNNSSPEEKLVTDDNTASETHDSGREGELAQSGKTLHSDESVDGDGSPTRSQSHPADKSDNVTP
LDEIQKVGSSVVEDVDMDVDMEVEESVSLSPAQVIDASDTSNLHADVPPPPGEEWVPPPPSEVEDVPPPPPDSFSEPVPP
PPLENDHALPPLSSDSVGVPYTVPQSYIQQSADYAAQYNLSYPESSYQYITNAVAPNTQFYGQVDGSQVSLPQSAYYYDT
VPGTSEVAPVEAYYNLNGVAPLFPVSAEASLNHSGVGSASYNIPSDSSKAVEPSSKSNDSAEAASLGIATQSTDGSSQLA
KGQSKVKRPKKRTVSATTSTLRSNKKVSSLVDKWKAAKEELNDSEEEEEEDDYGVLDRKRRREIEEWKSRQIASGEAKDN
ANFQPLGGDWREKVKRRKERTGREADEPKKKDEKQQKPDLTKLSAHLPSGWQAYWDESTKKAYYGNTVTSESSWTRPTTN
N*

DNA
ATGGGGAAGAGGAAAGAGCGTCGCTTCGCCGCTAATAATACGAGTCGTCGTGTCAAGCTTGATCTCTTCGCTGAACCCTC
TGGAGATTTGGGTGGCTCAGATGTGCGTAGTGATGGAGATGAGAAGGAACAAACAGAGCCTAATGAGTTACCTAAGTCAC
CTTCTTCTTCAGGCCAGAAAACAGAGAACCCTTTGCTTTTACTTGGACAATATAGTGATGAGGAGGAGGAGGTGGAAGAT
GAGAAAGAGGATAAGGCAGATGATGCCACTGCCGAAAGTTCTTTAGCCAATAAAAATGAGAAGGTTGAAGCACGCAAAGA
TACAAATGTCAAATCTGGTGCAGACACGACTATGCAGATGGTTGACCAACAACAAACAGGGGAGGATTCTTCTGCTTCTT
ATTATATGGCGGAAGGGGGAAGTGGTTATGTCACAGCAAGTAACTCAACTGCCGCGGATGGACTTACCAAGCAGATAGAT
CCCTCCGTGCAAGCATCTGCCACCGTGTCTTTGGAGCAGTATGCTCCCACGGATGTTACTTCGCAGTGGAAGATGATTTT
GCACGAGGAGAGCAATCAGTATTACTACTGGAACACACTAACTGGGGAAACTTCATGGGAAATTCCTCCGGTTTTGAGTC
AAACTGCTACGGCATATGGGACTGGATATCATGAGTCTGGGGCTATGGTTACAGACGCGTACAACTTGAGTTCTGGTGTT
GAACCAAGCTATTTGCAACAACCCGTGGAAAATGTTTATACAGGAACTGATTGTTCGACCTCTCTGACAGCTCAGCCGGG
TGAAGGAAACAAAAGTGAAGATCATTATGCCAAAAGCTTCGGAACTGATGGTCATCAAGTTGAATGTCAGATAGACTCTG
CTGTTAATTACCAACCATCTCAGGAGGAGCTTGCAGGGCCAAGAAATTCAGATCATGTGCAGGCTACTGCTGTTCAAGTA
TCGGCTACTGACCTCCCGTCTCGCCTGTTGAGCCAAAGCGAAGGCTTACTGGAGAAGCTGAGGTCTCTGAAGAAGTCTCA
TGGGAACTTTAACAGCAATGAGCAGATATCAAAGTACATACTGGAGCTTGAAGTGAGACATTCTGATGTAAAGGCGCTGT
TAAATGATACCTCACCTTTACTTTCCTTTTGGCTCCACACTGAGAAAGAACTCAAGCGTCTGGAAGACGGCGTTAACGAT
GAGATTTACGAGCTTGCAAAATCTGCAGTAATGGATGGAATTGCAGAAACTAACAATAGCTCTCCCGAAGAAAAGTTGGT
GACAGATGATAATACAGCAAGTGAAACTCATGACAGTGGGAGAGAAGGAGAGTTAGCTCAATCCGGAAAAACTCTTCATT
CAGATGAATCAGTGGATGGTGATGGATCTCCCACCCGCTCCCAAAGCCATCCAGCTGACAAGTCTGATAATGTTACTCCT
TTAGATGAGATTCAGAAGGTAGGCTCCTCAGTTGTGGAAGATGTTGACATGGATGTGGATATGGAGGTTGAAGAATCAGT
TTCATTGTCTCCTGCTCAAGTGATAGATGCTTCAGATACATCCAACCTTCACGCAGATGTTCCACCGCCTCCGGGGGAAG
AGTGGGTTCCACCACCACCTTCTGAGGTTGAAGATGTTCCACCACCACCGCCTGATAGTTTTAGTGAACCAGTTCCTCCA
CCTCCTCTTGAAAACGATCATGCCCTTCCACCCTTGTCCAGTGACTCTGTGGGAGTACCCTACACCGTACCGCAATCTTA
TATACAGCAATCTGCTGATTATGCTGCACAATACAACTTATCCTATCCAGAGTCCAGTTACCAATATATTACCAATGCTG
TTGCTCCTAACACTCAGTTCTATGGCCAAGTCGACGGATCTCAAGTCTCTCTGCCCCAGTCGGCATATTACTACGACACT
GTTCCTGGTACAAGTGAAGTTGCTCCTGTTGAAGCTTATTACAATCTCAATGGCGTAGCTCCGCTCTTTCCAGTCTCTGC
GGAGGCATCACTGAATCACAGTGGAGTTGGTTCTGCTAGCTACAACATCCCAAGCGATTCTTCTAAAGCTGTAGAGCCTA
GCTCCAAATCCAATGATTCTGCTGAAGCAGCATCTTTGGGCATTGCTACTCAGTCCACAGACGGATCGTCTCAGTTAGCA
AAGGGCCAATCTAAAGTGAAACGGCCTAAAAAGCGGACAGTTTCTGCCACTACATCCACATTGAGGTCAAATAAAAAGGT
TTCGAGTTTGGTGGACAAGTGGAAAGCTGCGAAAGAGGAGCTAAACGATAGCGAAGAAGAGGAAGAAGAAGATGATTACG
GGGTCCTGGATAGAAAACGACGACGAGAAATCGAAGAATGGAAGTCACGACAGATTGCGAGTGGAGAGGCTAAAGACAAT
GCTAACTTCCAACCCCTCGGTGGTGACTGGCGTGAGAAAGTAAAAAGGAGGAAAGAACGAACGGGACGTGAAGCTGATGA
GCCTAAGAAAAAAGACGAGAAGCAACAAAAGCCTGATCTGACAAAACTCTCAGCACATCTTCCCTCTGGATGGCAGGCGT
ATTGGGACGAGTCTACCAAAAAAGCTTACTATGGGAATACAGTTACATCTGAATCCTCTTGGACACGACCCACCACCAAC
AACTGA