Details for Chinese cabbage Locus Brara.A03272

Position : A01 ( 5`- 27262056 .. 27265248 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03272

Protein [Map View]
MRITVMTAGEQIITLDVDSHETVENVKALLEVEANVPIQQQQLLYNGNEMRNSDKLSALGVKDDDLLMMMVSNASSGSVG
GSDLGMNPDGSASNPAAFQQHIRGDANIMGQLFQTDPELAQVISGSDLNKLQDVLRSRHQQRSVAQRQKEEELALLYADP
FDVEAQKKIEAAIRQKGIDENWEAALEHNPEGFARVIMLYVDMEVNGIPLKAFVDSGAQSTIISKSCAERCGLLRLMDQR
YKGIAQGVGQTEILGRIHVAPIKIGKNFYPCSFIVLDSPNMEFLFGLDMLRKHQCTIDLKDNVLTVGGGEVSVPFLQEKD
LPSRFLDEGGVPNQASSSGAAVPSEFTEKKSNAVASPASQPSRSEGPEFEAKIAKLVELGFSREAVVQALRLFEGNEEQA
AGFLFGG*

DNA
ATGAGGATCACCGTGATGACCGCCGGCGAACAAATCATCACCCTCGACGTCGATTCACACGAAACCGTTGAGAATGTTAA
AGCCTTGCTCGAGGTTGAGGCGAATGTTCCGATTCAGCAGCAGCAGCTCTTGTACAATGGCAATGAGATGAGGAACTCTG
ATAAATTGAGTGCATTGGGTGTTAAAGATGATGATTTGTTGATGATGATGGTTTCCAACGCCTCATCTGGTAGTGTGGGA
GGGAGTGATTTGGGTATGAATCCTGATGGGTCAGCTTCGAACCCTGCAGCTTTCCAGCAGCATATTCGGGGTGATGCTAA
TATTATGGGACAGTTATTCCAGACTGATCCTGAGCTTGCACAAGTGATTTCTGGAAGCGATTTAAATAAGTTACAGGATG
TTTTGCGTTCGAGGCATCAACAGCGATCTGTAGCGCAGCGTCAGAAGGAGGAGGAACTTGCCCTATTGTATGCAGATCCT
TTTGATGTTGAAGCACAGAAGAAAATCGAAGCTGCAATTCGGCAGAAAGGAATTGATGAGAACTGGGAAGCTGCCCTTGA
ACATAACCCCGAAGGTTTTGCTCGGGTGATAATGCTGTATGTGGATATGGAGGTCAATGGTATACCTCTAAAGGCTTTTG
TTGATAGTGGTGCTCAATCTACAATCATATCCAAGAGTTGTGCTGAGAGATGCGGATTGCTGAGACTGATGGATCAACGG
TATAAAGGTATTGCTCAGGGTGTTGGCCAAACAGAGATATTAGGCCGCATTCATGTCGCTCCAATCAAGATTGGAAAAAA
CTTTTACCCGTGTTCATTCATAGTGCTGGACTCACCTAACATGGAGTTCCTTTTTGGACTTGATATGCTGCGTAAGCATC
AGTGCACTATTGATTTGAAAGATAACGTCCTGACTGTTGGAGGAGGAGAGGTCTCGGTTCCCTTTTTGCAAGAGAAAGAC
CTCCCTTCTCGGTTCCTGGATGAAGGTGGTGTTCCGAATCAAGCATCAAGCTCTGGAGCAGCGGTTCCTTCTGAGTTTAC
AGAGAAGAAGAGTAACGCAGTTGCAAGCCCAGCGAGTCAACCTTCAAGATCAGAGGGACCTGAGTTTGAAGCGAAGATTG
CAAAGCTTGTTGAGTTAGGCTTCTCCAGAGAAGCAGTGGTGCAAGCTCTGAGATTGTTTGAAGGAAACGAAGAACAAGCT
GCTGGGTTTCTCTTTGGTGGATGA