Details for Chinese cabbage Locus Brara.A03271

Position : A01 ( 5`- 27260912 .. 27261536 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03271

Protein [Map View]
MCCGRICMLCTCLVLVVITIGFLFGFGVFKDGFHKIHDSGKLECDPRFGCGGGVGVGRRGYGFPGNN*

DNA
ATGTGTTGTGGACGGATATGCATGCTGTGCACGTGTTTGGTTCTGGTGGTGATCACGATTGGTTTTCTATTCGGGTTTGG
AGTTTTTAAGGACGGTTTCCACAAGATCCACGATTCCGGTAAACTCGAATGCGATCCCAGATTCGGCTGCGGCGGAGGCG
TTGGCGTTGGCCGTCGCGGTTACGGCTTCCCCGGTAATAACTAG