Details for Chinese cabbage Locus Brara.A03269

Position : A01 ( 5`- 27253167 .. 27256254 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03269

Protein [Map View]
MSHCNVPALIEAQVEMGSANEVEQKTLFKLEEDAKQAKEASLMEQGGSLSPTFPPHTTKSPKNTVLKSIRIVILSNKLNL
LLPFGPLAILVHYMIDSKGWVFLLSLIGITPLAERLGYATEQLAFYTGPTVGGLLNATFGNVTELIISIFALKNGMIRVV
QLTLLGSILSNMLLVLGCAFFCGGLVFHQKDQVFDKGLAVVNSGLLLMAVMGILFPAVLHYTHSEVHAGSSELALSRFSS
CIMLIAYAAYLFFQLKSQSSSYSPLEEETNQNEEASSDEDPEISKWESIIWLSILTAWVSLLSGYLVDAIEGASVSWNIP
IAFISVILLPIVGNAAEHAGAIMFAMKDKLDLSLGVAIGSSIQISMFAVPFCVVIGWMMGEQMDLNFQLFETAMLFITVI
VVAFFIQEGTSNYFKGLMLILCYLIVAASFFVHEDPQQDGGI*

DNA
ATGAGTCATTGTAACGTCCCGGCTCTTATTGAAGCACAAGTTGAAATGGGGTCGGCTAATGAAGTTGAGCAAAAAACCTT
ATTCAAACTCGAAGAAGATGCCAAGCAAGCTAAAGAAGCTTCTTTGATGGAGCAAGGAGGATCACTCTCTCCAACTTTCC
CTCCACACACCACTAAATCACCAAAGAACACCGTCCTTAAAAGCATCAGGATCGTTATTTTATCTAACAAACTCAACCTG
TTACTACCTTTCGGTCCTCTAGCAATACTGGTCCACTACATGATAGATAGTAAAGGATGGGTGTTTCTGCTGAGCTTAAT
AGGCATCACACCATTAGCTGAGCGTCTAGGATACGCCACAGAGCAACTTGCTTTTTACACTGGCCCTACTGTGGGAGGCC
TCCTAAACGCTACATTTGGGAACGTGACTGAACTGATCATATCCATCTTCGCTTTGAAAAACGGAATGATACGTGTAGTT
CAGCTGACTTTGTTAGGATCGATTCTTTCCAACATGTTGCTTGTACTCGGCTGCGCTTTCTTCTGCGGTGGGCTAGTGTT
TCACCAGAAAGACCAAGTCTTTGACAAAGGGCTTGCGGTTGTTAATTCAGGTTTGCTTTTGATGGCTGTAATGGGGATAC
TCTTCCCTGCTGTTCTTCACTACACGCATAGTGAGGTTCATGCAGGATCGTCGGAGCTGGCATTGTCGAGGTTTAGCAGT
TGTATAATGCTTATAGCTTATGCTGCTTACCTTTTCTTCCAGTTGAAGAGCCAGTCTAGTTCTTATAGCCCTCTTGAAGA
GGAAACGAATCAGAACGAGGAAGCTAGTTCTGATGAAGATCCTGAGATCTCAAAGTGGGAATCTATCATATGGCTCTCGA
TATTGACTGCTTGGGTCTCTCTTCTCTCTGGCTATCTTGTTGATGCCATTGAGGGTGCATCGGTCTCTTGGAACATACCA
ATAGCGTTTATAAGTGTCATATTGCTTCCTATTGTTGGGAACGCAGCGGAGCATGCAGGTGCTATCATGTTTGCCATGAA
AGATAAACTGGATCTGTCGTTGGGCGTGGCTATTGGTTCCTCTATCCAGATCTCCATGTTCGCGGTCCCGTTCTGTGTGG
TGATTGGATGGATGATGGGTGAACAGATGGATCTTAATTTTCAGCTTTTTGAGACGGCCATGTTGTTTATTACCGTTATA
GTAGTTGCTTTTTTCATCCAGGAAGGGACATCGAATTACTTCAAAGGGTTGATGCTCATTCTTTGTTATTTAATAGTAGC
TGCCAGTTTCTTTGTACACGAAGATCCTCAACAAGATGGAGGTATATAA