Details for Chinese cabbage Locus Brara.A03268

Position : A01 ( 5`- 27249350 .. 27251064 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03268

Protein [Map View]
MEKVSVNGVLVSPDDGIGSPQRSSSVDSLKVESPGGSTRKGFGLKKWRRIKRDTPVKDESAAPVDDGSKLLKRNLTGLVN
PPSKHVDLSSVEARQGSEGSVGSVNMMAHHHHHHLPSVVNGFSPGPGLFTVGQGFEKSEEHSGGGKIDSGSQGRDTIKNG
SEERIDSDLRSSDFVFSSGAVSAANRIADGQEARELVETYSRSENGGEDEDGVESHKKNNHYQADKDQIADSIRCLAALQ
EALWKEVTSFQELSKESIPPLHSNIDEDNSGSQVLILKQKVKLLQVKLEEARADLDAKEARIQELENAKIEAELEGVFQR
KMEAEIQHLMLTSSLNSTLLKEHPKKVHSVAEDPEPNRGNMLGKTCKSSFYFLIQLILLVSIVRLLLLQSSPASQLVIPT
*

DNA
ATGGAGAAAGTGAGTGTAAATGGAGTACTAGTATCGCCTGATGATGGTATTGGATCACCTCAACGATCCAGCAGCGTTGA
TAGCTTAAAGGTTGAATCTCCGGGTGGTTCGACGAGAAAAGGTTTCGGGTTGAAGAAATGGAGAAGGATCAAGAGAGATA
CTCCTGTGAAAGACGAGTCTGCTGCACCTGTTGATGACGGTAGTAAGTTGCTGAAGCGTAATTTGACTGGCTTGGTGAAC
CCTCCTTCTAAACATGTAGACTTGTCTTCGGTTGAAGCAAGACAGGGTAGTGAAGGCTCTGTTGGATCAGTAAACATGAT
GGCGCATCATCATCATCACCATCTTCCAAGTGTAGTCAACGGGTTTAGTCCCGGTCCAGGTTTGTTTACTGTAGGCCAAG
GTTTTGAGAAGAGTGAAGAGCATAGCGGAGGAGGGAAGATTGATTCAGGTAGCCAAGGGAGAGATACCATCAAGAATGGA
AGCGAAGAGCGCATAGATTCGGACTTGAGAAGTAGCGATTTTGTGTTTTCTAGTGGCGCAGTTTCTGCTGCCAACCGTAT
AGCAGATGGTCAAGAAGCTAGGGAACTAGTTGAAACATATAGCAGAAGCGAGAACGGAGGAGAAGATGAAGATGGAGTTG
AGAGTCATAAGAAGAACAACCATTATCAGGCAGACAAGGATCAAATAGCAGATTCTATCAGATGTCTTGCAGCTTTGCAG
GAAGCTCTTTGGAAAGAGGTTACAAGTTTCCAGGAGCTGAGTAAGGAATCTATACCACCACTACATTCGAATATTGATGA
AGACAATTCAGGATCACAGGTACTGATCTTGAAGCAGAAGGTGAAACTTCTCCAAGTTAAACTCGAGGAAGCGAGAGCTG
ATCTCGACGCAAAGGAAGCCAGAATCCAAGAACTCGAAAACGCGAAGATTGAAGCTGAACTTGAAGGTGTTTTCCAGAGA
AAGATGGAAGCTGAAATCCAGCATTTGATGCTCACAAGTTCTCTGAACTCAACGCTACTCAAAGAACATCCGAAGAAGGT
ACATTCTGTAGCTGAAGATCCTGAACCAAACCGTGGAAACATGTTGGGAAAAACATGCAAGTCCAGTTTCTATTTCTTGA
TACAGTTGATCTTGCTAGTCTCCATAGTTCGGTTACTGCTCCTCCAGTCCTCTCCTGCTTCACAATTAGTTATACCAACC
TGA